• Gene id: 10273

Gene Summary

• Gene Symbol: STUB1   Gene   UCSC   Ensembl
• Aliases: CHIP, HSPABP2, NY-CO-7, SCA48, SCAR16, SDCCAG7, UBOX1
• Gene name: STIP1 homology and U-box containing protein 1
• Alternate names: E3 ubiquitin-protein ligase CHIP, CLL-associated antigen KW-8, RING-type E3 ubiquitin transferase CHIP, STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase, antigen NY-CO-7, carboxy terminus of Hsp70-interacting protein, heat shock protei,
• Gene location: 16p13.3 (680409: 682800)     Exons: 7     NC_000016.10
• Gene summary(Entrez): This gene encodes a protein containing tetratricopeptide repeat and a U-box that functions as a ubiquitin ligase/cochaperone. The encoded protein binds to and ubiquitinates shock cognate 71 kDa protein (Hspa8) and DNA polymerase beta (Polb), among other t
• OMIM: 607207

Protein Summary

• Protein general information: Q9UNE7  
  • Name: E3 ubiquitin protein ligase CHIP (EC 2.3.2.27) (Antigen NY CO 7) (CLL associated antigen KW 8) (Carboxy terminus of Hsp70 interacting protein) (RING type E3 ubiquitin transferase CHIP) (STIP1 homology and U box containing protein 1)
  • Length: 303  
  • Mass: 34856
  • Tissue specificity: Expressed in differentiated myotubes (at protein level) (PubMed
• Sequence:

  MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQ
  HEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSI
  EERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKR
  DIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWV
  EDY

• Structural information:
  • Protein Domains: (226..30-)
    (/note="U-box"-)
  • Interpro: IPR041312  IPR013026  IPR011990  IPR019734  IPR003613   IPR013083  
  • Prosite: PS50005 PS50293 PS51698
  • PDB: 4KBQ 6EFK 6NSV
  • PDBsum: 4KBQ 6EFK 6NSV
  • DIP: 29752
  • STRING: ENSP00000219548
• Other Databases: GeneCards:  STUB1  Malacards:  STUB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048156	tau protein binding	NAS	molecular function
GO:0061630	ubiquitin protein ligase activity	IGI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0002931	response to ischemia	ISS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IGI	biological process
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0101031	chaperone complex	IPI	cellular component
GO:0071456	cellular response to hypoxia	ISS	biological process
GO:0034605	cellular response to heat	ISS	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0001664	G protein-coupled receptor binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0061630	ubiquitin protein ligase activity	IMP	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0030544	Hsp70 protein binding	IDA	molecular function
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IMP	biological process
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0051879	Hsp90 protein binding	IDA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0030544	Hsp70 protein binding	IDA	molecular function
GO:0030911	TPR domain binding	IDA	molecular function
GO:0046332	SMAD binding	IDA	molecular function
GO:0030674	protein-macromolecule adaptor activity	TAS	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031943	regulation of glucocorticoid metabolic process	IDA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0051604	protein maturation	TAS	biological process
GO:0031371	ubiquitin conjugating enzyme complex	TAS	cellular component
GO:0030579	ubiquitin-dependent SMAD protein catabolic process	IDA	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0031398	positive regulation of protein ubiquitination	IDA	biological process
GO:0045862	positive regulation of proteolysis	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0071218	cellular response to misfolded protein	IBA	biological process
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0006515	protein quality control for misfolded or incompletely synthesized proteins	IBA	biological process
GO:0030018	Z disc	IBA	cellular component
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0051087	chaperone binding	IBA	molecular function
GO:0070534	protein K63-linked ubiquitination	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0004842	ubiquitin-protein transferase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000209	protein polyubiquitination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0046332	SMAD binding	IPI	molecular function
GO:0030544	Hsp70 protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IMP	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0016567	protein ubiquitination	IDA	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	TAS	biological process
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038128	ERBB2 signaling pathway	TAS	biological process
GO:0061630	ubiquitin protein ligase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0034605	cellular response to heat	IEA	biological process
GO:0002931	response to ischemia	IEA	biological process
GO:0071218	cellular response to misfolded protein	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0051443	positive regulation of ubiquitin-protein transferase activity	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0034450	ubiquitin-ubiquitin ligase activity	IEA	molecular function
GO:0032091	negative regulation of protein binding	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0030968	endoplasmic reticulum unfolded protein response	IEA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0061684	chaperone-mediated autophagy	IEA	biological process
GO:0051087	chaperone binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0031398	positive regulation of protein ubiquitination	IEA	biological process
GO:0030018	Z disc	IEA	cellular component
GO:0006515	protein quality control for misfolded or incompletely synthesized proteins	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0061630	ubiquitin protein ligase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IDA	biological process
GO:0031647	regulation of protein stability	IDA	biological process
GO:0051787	misfolded protein binding	IDA	molecular function
GO:0016567	protein ubiquitination	IMP	biological process
GO:0051879	Hsp90 protein binding	IDA	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0071218	cellular response to misfolded protein	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0006515	protein quality control for misfolded or incompletely synthesized proteins	IDA	biological process
GO:0031398	positive regulation of protein ubiquitination	IDA	biological process
GO:0042405	nuclear inclusion body	IDA	cellular component
GO:0090035	positive regulation of chaperone-mediated protein complex assembly	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0034450	ubiquitin-ubiquitin ligase activity	ISS	molecular function
GO:0019899	enzyme binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Autosomal recessive spinocerebellar ataxias	KEGG:H01891
Autosomal recessive spinocerebellar ataxias	KEGG:H01891
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq