• Gene id: 10270

Gene Summary

• Gene Symbol: AKAP8   Gene   UCSC   Ensembl
• Aliases: AKAP 95, AKAP-8, AKAP-95, AKAP95
• Gene name: A-kinase anchoring protein 8
• Alternate names: A-kinase anchor protein 8, A kinase (PRKA) anchor protein 8, A-kinase anchor protein, 95kDa,
• Gene location: 19p13.12 (13698873: 13825078)     Exons: 17     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the A-kinase anchor protein family. A-kinase anchor proteins are scaffold proteins that contain a binding domain for the RI/RII subunit of protein kinase A (PKA) and recruit PKA and other signaling molecules to specific subce
• OMIM: 604692

Protein Summary

• Protein general information: O43823  
  • Name: A kinase anchor protein 8 (AKAP 8) (A kinase anchor protein 95 kDa) (AKAP 95)
  • Length: 692  
  • Mass: 76108
  • Tissue specificity: Highly expressed in heart, liver, skeletal muscle, kidney and pancreas. Expressed in mature dendritic cells. {ECO
• Sequence:

  MDQGYGGYGAWSAGPANTQGAYGTGVASWQGYENYNYYGAQNTSVTTGATYSYGPASWEAAKANDGGLAAGAPAM
  HMASYGPEPCTDNSDSLIAKINQRLDMMSKEGGRGGSGGGGEGIQDRESSFRFQPFESYDSRPCLPEHNPYRPSY
  SYDYEFDLGSDRNGSFGGQYSECRDPARERGSLDGFMRGRGQGRFQDRSNPGTFMRSDPFVPPAASSEPLSTPWN
  ELNYVGGRGLGGPSPSRPPPSLFSQSMAPDYGVMGMQGAGGYDSTMPYGCGRSQPRMRDRDRPKRRGFDRFGPDG
  TGRKRKQFQLYEEPDTKLARVDSEGDFSENDDAAGDFRSGDEEFKGEDELCDSGRQRGEKEDEDEDVKKRREKQR
  RRDRTRDRAADRIQFACSVCKFRSFDDEEIQKHLQSKFHKETLRFISTKLPDKTVEFLQEYIVNRNKKIEKRRQE
  LMEKETAKPKPDPFKGIGQEHFFKKIEAAHCLACDMLIPAQPQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKS
  VLNNRHIVKMLEKYLKGEDPFTSETVDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESS
  GEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAESAQTRVAPAPAAAD
  AEVEQTDAESKDAVPTE

• Structural information:
  • Interpro: IPR007071  IPR034736  
  • Prosite: PS51799
  • DIP: 38194
  • STRING: ENSP00000269701
• Other Databases: GeneCards:  AKAP8  Malacards:  AKAP8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IDA	cellular component
GO:0016363	nuclear matrix	IBA	cellular component
GO:0034237	protein kinase A regulatory subunit binding	IBA	molecular function
GO:0042826	histone deacetylase binding	IDA	molecular function
GO:0044839	cell cycle G2/M phase transition	IMP	biological process
GO:0016363	nuclear matrix	ISS	cellular component
GO:0033127	regulation of histone phosphorylation	IMP	biological process
GO:0031065	positive regulation of histone deacetylation	IMP	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0000278	mitotic cell cycle	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034237	protein kinase A regulatory subunit binding	IEA	molecular function
GO:0016363	nuclear matrix	IEA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0071380	cellular response to prostaglandin E stimulus	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IEA	biological process
GO:0016363	nuclear matrix	IEA	cellular component
GO:0007076	mitotic chromosome condensation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0051059	NF-kappaB binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0001939	female pronucleus	IEA	cellular component
GO:0000793	condensed chromosome	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0016363	nuclear matrix	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0034237	protein kinase A regulatory subunit binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881