• Gene id: 10268

Gene Summary

• Gene Symbol: RAMP3   Gene   UCSC   Ensembl
• Gene name: receptor activity modifying protein 3
• Alternate names: receptor activity-modifying protein 3, CRLR activity-modifying protein 3, calcitonin receptor-like receptor activity modifying protein 3, receptor (G protein-coupled) activity modifying protein 3, receptor (calcitonin) activity modifying protein 3,
• Gene location: 7p13 (45157777: 45184249)     Exons: 6     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytop
• OMIM: 610899

Protein Summary

• Protein general information: O60896  
  • Name: Receptor activity modifying protein 3 (Calcitonin receptor like receptor activity modifying protein 3) (CRLR activity modifying protein 3)
  • Length: 148  
  • Mass: 16518
  • Tissue specificity: Strongly expressed in lung, breast, immune system and fetal tissues. {ECO
• Sequence:

  METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEM
  EANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL

• Structural information:
  • Interpro: IPR006985  IPR038126  
  • STRING: ENSP00000242249
• Other Databases: GeneCards:  RAMP3  Malacards:  RAMP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001540	amyloid-beta binding	IC	molecular function
GO:0005623	obsolete cell	IDA	cellular component
GO:0150058	amylin receptor complex 3	IDA	cellular component
GO:0097643	amylin receptor activity	IGI	contributes to
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IGI	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IGI	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IGI	biological process
GO:1904645	response to amyloid-beta	IGI	biological process
GO:0097647	amylin receptor signaling pathway	IGI	biological process
GO:0097647	amylin receptor signaling pathway	IGI	biological process
GO:0010628	positive regulation of gene expression	IGI	biological process
GO:0010628	positive regulation of gene expression	IGI	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IGI	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IGI	biological process
GO:1905665	positive regulation of calcium ion import across plasma membrane	IGI	biological process
GO:1905665	positive regulation of calcium ion import across plasma membrane	IGI	biological process
GO:0010942	positive regulation of cell death	IGI	biological process
GO:0010942	positive regulation of cell death	IGI	biological process
GO:0010739	positive regulation of protein kinase A signaling	IGI	biological process
GO:0010739	positive regulation of protein kinase A signaling	IGI	biological process
GO:0051897	positive regulation of protein kinase B signaling	IGI	biological process
GO:0051897	positive regulation of protein kinase B signaling	IGI	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IGI	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IGI	biological process
GO:0072659	protein localization to plasma membrane	IBA	biological process
GO:0043235	receptor complex	IBA	cellular component
GO:0006816	calcium ion transport	IBA	biological process
GO:0001525	angiogenesis	IBA	biological process
GO:0032870	cellular response to hormone stimulus	IBA	biological process
GO:0031623	receptor internalization	IBA	biological process
GO:0015031	protein transport	IBA	biological process
GO:0015026	coreceptor activity	IBA	molecular function
GO:0009986	cell surface	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:1903078	positive regulation of protein localization to plasma membrane	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0071392	cellular response to estradiol stimulus	ISS	biological process
GO:0086103	G protein-coupled receptor signaling pathway involved in heart process	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0015026	coreceptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005764	lysosome	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071392	cellular response to estradiol stimulus	IEA	biological process
GO:0015026	coreceptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0015026	coreceptor activity	IEA	molecular function
GO:0086103	G protein-coupled receptor signaling pathway involved in heart process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006816	calcium ion transport	IDA	biological process
GO:0005764	lysosome	IDA	colocalizes with
GO:0031623	receptor internalization	IDA	biological process
GO:0015031	protein transport	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:1903143	adrenomedullin receptor complex	IDA	cellular component
GO:0072659	protein localization to plasma membrane	IDA	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0031623	receptor internalization	IDA	biological process
GO:0015031	protein transport	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	colocalizes with
GO:0001921	positive regulation of receptor recycling	IDA	biological process
GO:0038041	cross-receptor inhibition within G protein-coupled receptor heterodimer	IPI	biological process
GO:0001605	adrenomedullin receptor activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990410	adrenomedullin receptor signaling pathway	IPI	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	biological process

KEGG pathways

Pathway id	Pathway name
hsa04270	Vascular smooth muscle contraction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq