• Gene id: 10266

Gene Summary

• Gene Symbol: RAMP2   Gene   UCSC   Ensembl
• Gene name: receptor activity modifying protein 2
• Alternate names: receptor activity-modifying protein 2, CRLR activity-modifying protein 2, calcitonin receptor-like receptor activity modifying protein 2, receptor (G protein-coupled) activity modifying protein 2, receptor (calcitonin) activity modifying protein 2,
• Gene location: 17q21.2 (42761226: 42763040)     Exons: 4     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytop
• OMIM: 605154

Protein Summary

• Protein general information: O60895  
  • Name: Receptor activity modifying protein 2 (Calcitonin receptor like receptor activity modifying protein 2) (CRLR activity modifying protein 2)
  • Length: 175  
  • Mass: 19608
  • Tissue specificity: Strongly expressed in lung, breast, immune system and fetal tissues. {ECO
• Sequence:

  MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQ
  MDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMI
  IAPICLIPFLITLVVWRSKDSEAQA

• Structural information:
  • Interpro: IPR006985  IPR038126  
  • PDB: 2XVT 3AQE 3AQF 4RWF
  • PDBsum: 2XVT 3AQE 3AQF 4RWF
  • STRING: ENSP00000253796
• Other Databases: GeneCards:  RAMP2  Malacards:  RAMP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005623	obsolete cell	IDA	cellular component
GO:0150057	amylin receptor complex 2	IDA	cellular component
GO:0097643	amylin receptor activity	IGI	contributes to
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IGI	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IGI	biological process
GO:0097647	amylin receptor signaling pathway	IGI	biological process
GO:0072659	protein localization to plasma membrane	IBA	biological process
GO:0043235	receptor complex	IBA	cellular component
GO:0006816	calcium ion transport	IBA	biological process
GO:0001525	angiogenesis	IBA	biological process
GO:0032870	cellular response to hormone stimulus	IBA	biological process
GO:0031623	receptor internalization	IBA	biological process
GO:0015031	protein transport	IBA	biological process
GO:0015026	coreceptor activity	IBA	molecular function
GO:0009986	cell surface	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0015026	coreceptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005764	lysosome	TAS	cellular component
GO:0005905	clathrin-coated pit	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001214	positive regulation of vasculogenesis	IEA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IEA	biological process
GO:0097084	vascular smooth muscle cell development	IEA	biological process
GO:0070830	bicellular tight junction assembly	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IEA	biological process
GO:0015026	coreceptor activity	IEA	molecular function
GO:0007507	heart development	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0032870	cellular response to hormone stimulus	IEA	biological process
GO:0031623	receptor internalization	IEA	biological process
GO:0015026	coreceptor activity	IEA	molecular function
GO:0070831	basement membrane assembly	IEA	biological process
GO:0043116	negative regulation of vascular permeability	IEA	biological process
GO:0034333	adherens junction assembly	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0008217	regulation of blood pressure	IEA	biological process
GO:0002040	sprouting angiogenesis	IEA	biological process
GO:0032570	response to progesterone	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032092	positive regulation of protein binding	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0072659	protein localization to plasma membrane	IDA	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:0070830	bicellular tight junction assembly	IDA	biological process
GO:0031623	receptor internalization	IDA	biological process
GO:0031623	receptor internalization	IDA	biological process
GO:0015031	protein transport	IDA	biological process
GO:0015031	protein transport	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0005886	plasma membrane	IDA	colocalizes with
GO:0005737	cytoplasm	IDA	cellular component
GO:1903143	adrenomedullin receptor complex	IDA	cellular component
GO:0043116	negative regulation of vascular permeability	IDA	biological process
GO:0034333	adherens junction assembly	IDA	biological process
GO:0006816	calcium ion transport	IDA	biological process
GO:0031623	receptor internalization	IDA	biological process
GO:1903143	adrenomedullin receptor complex	IDA	cellular component
GO:1903143	adrenomedullin receptor complex	IDA	cellular component
GO:1903143	adrenomedullin receptor complex	IDA	cellular component
GO:0008217	regulation of blood pressure	ISS	biological process
GO:0097084	vascular smooth muscle cell development	ISS	biological process
GO:0045766	positive regulation of angiogenesis	ISS	biological process
GO:1990410	adrenomedullin receptor signaling pathway	IPI	biological process
GO:0070831	basement membrane assembly	ISS	biological process
GO:0002040	sprouting angiogenesis	ISS	biological process
GO:0001570	vasculogenesis	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	ISS	biological process
GO:0015026	coreceptor activity	ISS	molecular function
GO:0007507	heart development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	biological process
GO:0001605	adrenomedullin receptor activity	IPI	molecular function
GO:0001605	adrenomedullin receptor activity	IPI	molecular function
GO:1990410	adrenomedullin receptor signaling pathway	IPI	biological process
GO:0001605	adrenomedullin receptor activity	IPI	molecular function
GO:1990409	adrenomedullin binding	IPI	molecular function
GO:1990410	adrenomedullin receptor signaling pathway	IPI	biological process
GO:1990410	adrenomedullin receptor signaling pathway	IPI	biological process

KEGG pathways

Pathway id	Pathway name
hsa04270	Vascular smooth muscle contraction

Diseases

Associated diseases	References
Hypertension	PMID:11600589
Hypertension	PMID:15797661
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881