• Gene id: 10263

Gene Summary

• Gene Symbol: CDK2AP2   Gene   UCSC   Ensembl
• Aliases: DOC-1R, p14
• Gene name: cyclin dependent kinase 2 associated protein 2
• Alternate names: cyclin-dependent kinase 2-associated protein 2, CDK2-associated protein 2, DOC-1-related protein, tumor suppressor deleted in oral cancer related 1,
• Gene location: 11q13.2 (67508161: 67506496)     Exons: 4     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein that interacts with cyclin-dependent kinase 2 associated protein 1. Pseudogenes associated with this gene are located on chromosomes 7 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided

Protein Summary

• Protein general information: O75956  
  • Name: Cyclin dependent kinase 2 associated protein 2 (CDK2 associated protein 2) (DOC 1 related protein) (DOC 1R)
  • Length: 126  
  • Mass: 13101
  • Tissue specificity: Ubiquitous.
• Sequence:

  MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYT
  DLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART

• Structural information:
  • Interpro: IPR017266  
  • PDB: 2M1L
  • PDBsum: 2M1L
  • STRING: ENSP00000301488
• Other Databases: GeneCards:  CDK2AP2  Malacards:  CDK2AP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	IMP	biological process
GO:0005874	microtubule	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:2000035	regulation of stem cell division	ISS	biological process
GO:0070507	regulation of microtubule cytoskeleton organization	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0070507	regulation of microtubule cytoskeleton organization	IEA	biological process
GO:2000035	regulation of stem cell division	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq