Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 1026
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol CDKN1A   Gene   UCSC   Ensembl
Aliases CAP20, CDKN1, CIP1, MDA-6, P21, SDI1, WAF1, p21CIP1
Gene name cyclin dependent kinase inhibitor 1A
Alternate names cyclin-dependent kinase inhibitor 1, CDK-interacting protein 1, CDK-interaction protein 1, DNA synthesis inhibitor, cyclin-dependent kinase inhibitor 1A (p21, Cip1), melanoma differentiation associated protein 6, wild-type p53-activated fragment 1,
Gene location 6p21.2 (36676462: 36687331)     Exons: 6     NC_000006.12
Gene summary(Entrez) This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-cyclin-dependent kinase2 or -cyclin-dependent kinase4 complexes, and thus functions as a regulator of cell cycle progression at
OMIM 614478

Protein Summary
Protein general information P38936  

Name: Cyclin dependent kinase inhibitor 1 (CDK interacting protein 1) (Melanoma differentiation associated protein 6) (MDA 6) (p21)

Length: 164  Mass: 18119

Tissue specificity: Expressed in all adult tissues, with 5-fold lower levels observed in the brain.

Sequence MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRGLGLPK
LYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDF
YHSKRRLIFSKRKP
Structural information
Interpro:  IPR003175  IPR029841  

PDB:  		 1AXC 2ZVV 2ZVW 4RJF 5E0U 6CBI 6CEJ 6CIV 6CIX 6P8H
PDBsum:   1AXC 2ZVV 2ZVW 4RJF 5E0U 6CBI 6CEJ 6CIV 6CIX 6P8H

DIP:  
246
MINT:  
STRING:   ENSP00000384849
Other Databases GeneCards:  CDKN1A  Malacards:  CDKN1A

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005634 nucleus
 IDA cellular component
GO:0070557 PCNA-p21 complex
 IDA cellular component
GO:0007095 mitotic G2 DNA damage che
ckpoint
 IMP biological process
GO:0031625 ubiquitin protein ligase
binding
 IPI molecular function
GO:0034198 cellular response to amin
o acid starvation
 IMP biological process
GO:0007050 cell cycle arrest
 IMP biological process
GO:0071493 cellular response to UV-B
 ISS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:1902806 regulation of cell cycle
G1/S phase transition
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
 IEA molecular function
GO:0007050 cell cycle arrest
 IEA biological process
GO:0072331 signal transduction by p5
3 class mediator
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0007346 regulation of mitotic cel
l cycle
 IEA biological process
GO:0046872 metal ion binding
 IEA molecular function
GO:0007049 cell cycle
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0004860 protein kinase inhibitor
activity
 IEA molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
 TAS molecular function
GO:0000079 regulation of cyclin-depe
ndent protein serine/thre
onine kinase activity
 TAS biological process
GO:0097193 intrinsic apoptotic signa
ling pathway
 TAS biological process
GO:0032991 protein-containing comple
x
 IDA cellular component
GO:0005730 nucleolus
 IDA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0045860 positive regulation of pr
otein kinase activity
 IDA biological process
GO:2000134 negative regulation of G1
/S transition of mitotic
cell cycle
 IGI biological process
GO:0000082 G1/S transition of mitoti
c cell cycle
 TAS biological process
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0006357 regulation of transcripti
on by RNA polymerase II
 TAS biological process
GO:0006367 transcription initiation
from RNA polymerase II pr
omoter
 TAS biological process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 TAS biological process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 TAS biological process
GO:0019221 cytokine-mediated signali
ng pathway
 TAS biological process
GO:0050821 protein stabilization
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0060574 intestinal epithelial cel
l maturation
 IEA biological process
GO:0051384 response to glucocorticoi
d
 IEA biological process
GO:0048471 perinuclear region of cyt
oplasm
 IEA cellular component
GO:0043066 negative regulation of ap
optotic process
 IEA biological process
GO:0034605 cellular response to heat
 IEA biological process
GO:0014070 response to organic cycli
c compound
 IEA biological process
GO:0010243 response to organonitroge
n compound
 IEA biological process
GO:0010165 response to X-ray
 IEA biological process
GO:0010033 response to organic subst
ance
 IEA biological process
GO:0009636 response to toxic substan
ce
 IEA biological process
GO:0071480 cellular response to gamm
a radiation
 IEA biological process
GO:0051726 regulation of cell cycle
 IEA biological process
GO:0045736 negative regulation of cy
clin-dependent protein se
rine/threonine kinase act
ivity
 IEA biological process
GO:0043068 positive regulation of pr
ogrammed cell death
 IEA biological process
GO:0042771 intrinsic apoptotic signa
ling pathway in response
to DNA damage by p53 clas
s mediator
 IEA biological process
GO:0034198 cellular response to amin
o acid starvation
 IEA biological process
GO:0008285 negative regulation of ce
ll population proliferati
on
 IEA biological process
GO:0007050 cell cycle arrest
 IEA biological process
GO:0005829 cytosol
 IEA cellular component
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
 IEA molecular function
GO:0000307 cyclin-dependent protein
kinase holoenzyme complex
 IEA cellular component
GO:0090399 replicative senescence
 IEA biological process
GO:0007050 cell cycle arrest
 IEA biological process
GO:0055093 response to hyperoxia
 IEA biological process
GO:0051412 response to corticosteron
e
 IEA biological process
GO:0046685 response to arsenic-conta
ining substance
 IEA biological process
GO:0044877 protein-containing comple
x binding
 IEA molecular function
GO:0042493 response to drug
 IEA biological process
GO:0031100 animal organ regeneration
 IEA biological process
GO:0010942 positive regulation of ce
ll death
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:2000278 regulation of DNA biosynt
hetic process
 IEA biological process
GO:1905179 negative regulation of ca
rdiac muscle tissue regen
eration
 IEA biological process
GO:0071850 mitotic cell cycle arrest
 IEA biological process
GO:0071493 cellular response to UV-B
 IEA biological process
GO:0042246 tissue regeneration
 IEA biological process
GO:0030890 positive regulation of B
cell proliferation
 IEA biological process
GO:0030332 cyclin binding
 IEA molecular function
GO:0010629 negative regulation of ge
ne expression
 IEA biological process
GO:0009411 response to UV
 IEA biological process
GO:0007507 heart development
 IEA biological process
GO:0007346 regulation of mitotic cel
l cycle
 IEA biological process
GO:0006978 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
transcription of p21 cla
ss mediator
 IEA biological process
GO:0006974 cellular response to DNA
damage stimulus
 IEA biological process
GO:0006606 protein import into nucle
us
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0000079 regulation of cyclin-depe
ndent protein serine/thre
onine kinase activity
 IEA biological process
GO:2000379 positive regulation of re
active oxygen species met
abolic process
 IEA biological process
GO:0071479 cellular response to ioni
zing radiation
 IEA biological process
GO:0006974 cellular response to DNA
damage stimulus
 IEA biological process
GO:0030332 cyclin binding
 ISS molecular function
GO:0090398 cellular senescence
 IMP biological process
GO:0007507 heart development
 ISS biological process
GO:0071850 mitotic cell cycle arrest
 ISS biological process
GO:1905179 negative regulation of ca
rdiac muscle tissue regen
eration
 ISS biological process
GO:1904706 negative regulation of va
scular smooth muscle cell
proliferation
 IMP biological process
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
 TAS molecular function
GO:0000082 G1/S transition of mitoti
c cell cycle
 IDA biological process
GO:0000307 cyclin-dependent protein
kinase holoenzyme complex
 IDA cellular component
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 IDA biological process
GO:0007050 cell cycle arrest
 IDA biological process
GO:0008285 negative regulation of ce
ll population proliferati
on
 IDA biological process
GO:0008285 negative regulation of ce
ll population proliferati
on
 IDA biological process
GO:0030308 negative regulation of ce
ll growth
 IDA biological process
GO:0042326 negative regulation of ph
osphorylation
 IDA biological process
GO:0000086 G2/M transition of mitoti
c cell cycle
 IMP biological process
GO:0007050 cell cycle arrest
 IMP biological process
GO:0007265 Ras protein signal transd
uction
 IEP biological process
GO:0008285 negative regulation of ce
ll population proliferati
on
 IMP biological process
GO:0008285 negative regulation of ce
ll population proliferati
on
 IMP biological process
GO:0031668 cellular response to extr
acellular stimulus
 IMP biological process
GO:0090400 stress-induced premature
senescence
 TAS biological process
GO:0005634 nucleus
 IDA cellular component
GO:0006974 cellular response to DNA
damage stimulus
 IMP biological process
GO:0048146 positive regulation of fi
broblast proliferation
 IMP biological process
GO:0071479 cellular response to ioni
zing radiation
 IMP biological process
GO:0090398 cellular senescence
 IMP biological process
GO:2000379 positive regulation of re
active oxygen species met
abolic process
 IMP biological process
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0016604 nuclear body
 IDA cellular component
GO:1904031 positive regulation of cy
clin-dependent protein ki
nase activity
 IEA biological process
GO:1904030 negative regulation of cy
clin-dependent protein ki
nase activity
 IMP biological process
GO:0004860 protein kinase inhibitor
activity
 IMP molecular function
GO:0044877 protein-containing comple
x binding
 IPI molecular function
GO:0019901 protein kinase binding
 IPI molecular function
GO:0019912 cyclin-dependent protein
kinase activating kinase
activity
 IDA molecular function
GO:0140311 protein sequestering acti
vity
 IMP molecular function
GO:2000279 negative regulation of DN
A biosynthetic process
 IMP biological process
GO:0032091 negative regulation of pr
otein binding
 IMP biological process
GO:0070557 PCNA-p21 complex
 IMP cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0070557 PCNA-p21 complex
 IDA cellular component
GO:0007095 mitotic G2 DNA damage che
ckpoint
 IMP biological process
GO:0031625 ubiquitin protein ligase
binding
 IPI molecular function
GO:0034198 cellular response to amin
o acid starvation
 IMP biological process
GO:0007050 cell cycle arrest
 IMP biological process
GO:0071493 cellular response to UV-B
 ISS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:1902806 regulation of cell cycle
G1/S phase transition
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
 IEA molecular function
GO:0007050 cell cycle arrest
 IEA biological process
GO:0072331 signal transduction by p5
3 class mediator
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0007346 regulation of mitotic cel
l cycle
 IEA biological process
GO:0046872 metal ion binding
 IEA molecular function
GO:0007049 cell cycle
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0004860 protein kinase inhibitor
activity
 IEA molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
 TAS molecular function
GO:0000079 regulation of cyclin-depe
ndent protein serine/thre
onine kinase activity
 TAS biological process
GO:0097193 intrinsic apoptotic signa
ling pathway
 TAS biological process
GO:0032991 protein-containing comple
x
 IDA cellular component
GO:0005730 nucleolus
 IDA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0045860 positive regulation of pr
otein kinase activity
 IDA biological process
GO:2000134 negative regulation of G1
/S transition of mitotic
cell cycle
 IGI biological process
GO:0000082 G1/S transition of mitoti
c cell cycle
 TAS biological process
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0006357 regulation of transcripti
on by RNA polymerase II
 TAS biological process
GO:0006367 transcription initiation
from RNA polymerase II pr
omoter
 TAS biological process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 TAS biological process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 TAS biological process
GO:0019221 cytokine-mediated signali
ng pathway
 TAS biological process
GO:0050821 protein stabilization
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0060574 intestinal epithelial cel
l maturation
 IEA biological process
GO:0051384 response to glucocorticoi
d
 IEA biological process
GO:0048471 perinuclear region of cyt
oplasm
 IEA cellular component
GO:0043066 negative regulation of ap
optotic process
 IEA biological process
GO:0034605 cellular response to heat
 IEA biological process
GO:0014070 response to organic cycli
c compound
 IEA biological process
GO:0010243 response to organonitroge
n compound
 IEA biological process
GO:0010165 response to X-ray
 IEA biological process
GO:0010033 response to organic subst
ance
 IEA biological process
GO:0009636 response to toxic substan
ce
 IEA biological process
GO:0071480 cellular response to gamm
a radiation
 IEA biological process
GO:0051726 regulation of cell cycle
 IEA biological process
GO:0045736 negative regulation of cy
clin-dependent protein se
rine/threonine kinase act
ivity
 IEA biological process
GO:0043068 positive regulation of pr
ogrammed cell death
 IEA biological process
GO:0042771 intrinsic apoptotic signa
ling pathway in response
to DNA damage by p53 clas
s mediator
 IEA biological process
GO:0034198 cellular response to amin
o acid starvation
 IEA biological process
GO:0008285 negative regulation of ce
ll population proliferati
on
 IEA biological process
GO:0007050 cell cycle arrest
 IEA biological process
GO:0005829 cytosol
 IEA cellular component
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
 IEA molecular function
GO:0000307 cyclin-dependent protein
kinase holoenzyme complex
 IEA cellular component
GO:0090399 replicative senescence
 IEA biological process
GO:0007050 cell cycle arrest
 IEA biological process
GO:0055093 response to hyperoxia
 IEA biological process
GO:0051412 response to corticosteron
e
 IEA biological process
GO:0046685 response to arsenic-conta
ining substance
 IEA biological process
GO:0044877 protein-containing comple
x binding
 IEA molecular function
GO:0042493 response to drug
 IEA biological process
GO:0031100 animal organ regeneration
 IEA biological process
GO:0010942 positive regulation of ce
ll death
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:2000278 regulation of DNA biosynt
hetic process
 IEA biological process
GO:1905179 negative regulation of ca
rdiac muscle tissue regen
eration
 IEA biological process
GO:0071850 mitotic cell cycle arrest
 IEA biological process
GO:0071493 cellular response to UV-B
 IEA biological process
GO:0042246 tissue regeneration
 IEA biological process
GO:0030890 positive regulation of B
cell proliferation
 IEA biological process
GO:0030332 cyclin binding
 IEA molecular function
GO:0010629 negative regulation of ge
ne expression
 IEA biological process
GO:0009411 response to UV
 IEA biological process
GO:0007507 heart development
 IEA biological process
GO:0007346 regulation of mitotic cel
l cycle
 IEA biological process
GO:0006978 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
transcription of p21 cla
ss mediator
 IEA biological process
GO:0006974 cellular response to DNA
damage stimulus
 IEA biological process
GO:0006606 protein import into nucle
us
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0000079 regulation of cyclin-depe
ndent protein serine/thre
onine kinase activity
 IEA biological process
GO:2000379 positive regulation of re
active oxygen species met
abolic process
 IEA biological process
GO:0071479 cellular response to ioni
zing radiation
 IEA biological process
GO:0006974 cellular response to DNA
damage stimulus
 IEA biological process
GO:0030332 cyclin binding
 ISS molecular function
GO:0090398 cellular senescence
 IMP biological process
GO:0007507 heart development
 ISS biological process
GO:0071850 mitotic cell cycle arrest
 ISS biological process
GO:1905179 negative regulation of ca
rdiac muscle tissue regen
eration
 ISS biological process
GO:1904706 negative regulation of va
scular smooth muscle cell
proliferation
 IMP biological process
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
 TAS molecular function
GO:0000082 G1/S transition of mitoti
c cell cycle
 IDA biological process
GO:0000307 cyclin-dependent protein
kinase holoenzyme complex
 IDA cellular component
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 IDA biological process
GO:0007050 cell cycle arrest
 IDA biological process
GO:0008285 negative regulation of ce
ll population proliferati
on
 IDA biological process
GO:0008285 negative regulation of ce
ll population proliferati
on
 IDA biological process
GO:0030308 negative regulation of ce
ll growth
 IDA biological process
GO:0042326 negative regulation of ph
osphorylation
 IDA biological process
GO:0000086 G2/M transition of mitoti
c cell cycle
 IMP biological process
GO:0007050 cell cycle arrest
 IMP biological process
GO:0007265 Ras protein signal transd
uction
 IEP biological process
GO:0008285 negative regulation of ce
ll population proliferati
on
 IMP biological process
GO:0008285 negative regulation of ce
ll population proliferati
on
 IMP biological process
GO:0031668 cellular response to extr
acellular stimulus
 IMP biological process
GO:0090400 stress-induced premature
senescence
 TAS biological process
GO:0005634 nucleus
 IDA cellular component
GO:0006974 cellular response to DNA
damage stimulus
 IMP biological process
GO:0048146 positive regulation of fi
broblast proliferation
 IMP biological process
GO:0071479 cellular response to ioni
zing radiation
 IMP biological process
GO:0090398 cellular senescence
 IMP biological process
GO:2000379 positive regulation of re
active oxygen species met
abolic process
 IMP biological process
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0016604 nuclear body
 IDA cellular component
GO:1904031 positive regulation of cy
clin-dependent protein ki
nase activity
 IEA biological process
GO:1904030 negative regulation of cy
clin-dependent protein ki
nase activity
 IMP biological process
GO:0004860 protein kinase inhibitor
activity
 IMP molecular function
GO:0044877 protein-containing comple
x binding
 IPI molecular function
GO:0019901 protein kinase binding
 IPI molecular function
GO:0019912 cyclin-dependent protein
kinase activating kinase
activity
 IDA molecular function
GO:0140311 protein sequestering acti
vity
 IMP molecular function
GO:2000279 negative regulation of DN
A biosynthetic process
 IMP biological process
GO:0032091 negative regulation of pr
otein binding
 IMP biological process
GO:0070557 PCNA-p21 complex
 IMP cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05200Pathways in cancer
hsa04151PI3K-Akt signaling pathway
hsa05165Human papillomavirus infection
hsa05206MicroRNAs in cancer
hsa05166Human T-cell leukemia virus 1 infection
hsa05163Human cytomegalovirus infection
hsa05203Viral carcinogenesis
hsa05205Proteoglycans in cancer
hsa05169Epstein-Barr virus infection
hsa05167Kaposi sarcoma-associated herpesvirus infection
hsa05202Transcriptional misregulation in cancer
hsa05225Hepatocellular carcinoma
hsa04934Cushing syndrome
hsa04921Oxytocin signaling pathway
hsa04630JAK-STAT signaling pathway
hsa05226Gastric cancer
hsa04218Cellular senescence
hsa05161Hepatitis B
hsa05224Breast cancer
hsa05160Hepatitis C
hsa04110Cell cycle
hsa04068FoxO signaling pathway
hsa04928Parathyroid hormone synthesis, secretion and action
hsa04066HIF-1 signaling pathway
hsa05222Small cell lung cancer
hsa04012ErbB signaling pathway
hsa01522Endocrine resistance
hsa05210Colorectal cancer
hsa05220Chronic myeloid leukemia
hsa05215Prostate cancer
hsa05217Basal cell carcinoma
hsa05214Glioma
hsa05212Pancreatic cancer
hsa05211Renal cell carcinoma
hsa05218Melanoma
hsa04115p53 signaling pathway
hsa05223Non-small cell lung cancer
hsa05213Endometrial cancer
hsa01524Platinum drug resistance
hsa05216Thyroid cancer
hsa05219Bladder cancer

Diseases

Expand All | Collapse All
Associated diseases References
Cervical cancer KEGG:H00030
Cervical cancer KEGG:H00030
tongue squamous cell carcinoma PMID:12162767
oral squamous cell carcinoma PMID:15817070
oral squamous cell carcinoma PMID:10873097
oral squamous cell carcinoma PMID:10873097
Ductal carcinoma in situ PMID:12628841
Atrial fibrillation PMID:16043935
Prostate cancer PMID:18237448
primary open angle glaucoma PMID:14738489
Cholesteatoma of middle ear PMID:23324739
Sarcoidosis PMID:12885947
Fuchs' endothelial dystrophy PMID:22956607
Primary biliary cirrhosis PMID:18456456
acoustic neuroma PMID:20600642
Squamous cell carcinoma PMID:9655223
Squamous cell carcinoma PMID:11028856
Melanoma PMID:22311377
Papilloma PMID:11684723
Laryngeal squamous cell carcinoma PMID:15646812
Malignant glioma PMID:18791688
Malignant glioma PMID:20844987
Malignant glioma PMID:9144534
serous cystadenocarcinoma PMID:16012716
Inverted papilloma PMID:21608063
pancreatic ductal carcinoma PMID:17671118
Macular degeneration PMID:20054800
pancreatic carcinoma PMID:9252195
stomach carcinoma PMID:11745255
sebaceous gland neoplasm PMID:12354803
growth hormone secreting pituitary adenoma PMID:18981426
maxillary sinus squamous cell carcinoma PMID:15040115
Psoriasis PMID:7636313
autosomal dominant polycystic kidney disease PMID:17714589
cervix uteri carcinoma in situ PMID:9546362
Barrett's esophagus PMID:11753681
Ocular hypertension PMID:14985792
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Male factor infertility MIK: 29961538
Spermatogenic defects MIK: 31037746

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
29961538 Male facto
r infertil
ity
318 (128 couple
s presenting wi
th OAT (MF) and
118 maternal a
ge-matched cont
rol (no MF) sub
jects undergoin
g infertility t
reatment, 72 su
rplus cryoprese
rved blastocyst
s)
 Male infertility RNA-seq
 Show abstract
31037746 Spermatoge
nic defect
s
28 men with az
oospermia
 Male infertility Microarray
 Show abstract