• Gene id: 10257

Gene Summary

• Gene Symbol: ABCC4   Gene   UCSC   Ensembl
• Aliases: MOAT-B, MOATB, MRP4
• Gene name: ATP binding cassette subfamily C member 4
• Alternate names: multidrug resistance-associated protein 4, MRP/cMOAT-related ABC transporter, bA464I2.1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 4), canalicular multispecific organic anion transporter (ABC superfamily), multi-specific organic anion transporter ,
• Gene location: 13q32.1 (95301450: 95019834)     Exons: 36     NC_000013.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, M
• OMIM: 608061

Protein Summary

• Protein general information: O15439  
  • Name: Multidrug resistance associated protein 4 (ATP binding cassette sub family C member 4) (MRP/cMOAT related ABC transporter) (Multi specific organic anion transporter B) (MOAT B)
  • Length: 1325  
  • Mass: 149527
  • Tissue specificity: Widely expressed, with particularly high levels in prostate, but is barely detectable in liver.
• Sequence:

  MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEELQGFWDKEVLRAENDA
  QKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQPIFLGKIINYFENYDPMDSVALNTAYAYATVLTFCTLILAI
  LHHLYFYHVQCAGMRLRVAMCHMIYRKALRLSNMAMGKTTTGQIVNLLSNDVNKFDQVTVFLHFLWAGPLQAIAV
  TALLWMEIGISCLAGMAVLIILLPLQSCFGKLFSSLRSKTATFTDARIRTMNEVITGIRIIKMYAWEKSFSNLIT
  NLRKKEISKILRSSCLRGMNLASFFSASKIIVFVTFTTYVLLGSVITASRVFVAVTLYGAVRLTVTLFFPSAIER
  VSEAIVSIRRIQTFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWDKASETPTLQGLSFTVRPGELLAVVGPVGAG
  KSSLLSAVLGELAPSHGLVSVHGRIAYVSQQPWVFSGTLRSNILFGKKYEKERYEKVIKACALKKDLQLLEDGDL
  TVIGDRGTTLSGGQKARVNLARAVYQDADIYLLDDPLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAA
  SQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVWSQQSSRPSLKDGALE
  SQDTENVPVTLSEENRSEGKVGFQAYKNYFRAGAHWIVFIFLILLNTAAQVAYVLQDWWLSYWANKQSMLNVTVN
  GGGNVTEKLDLNWYLGIYSGLTVATVLFGIARSLLVFYVLVNSSQTLHNKMFESILKAPVLFFDRNPIGRILNRF
  SKDIGHLDDLLPLTFLDFIQTLLQVVGVVSVAVAVIPWIAIPLVPLGIIFIFLRRYFLETSRDVKRLESTTRSPV
  FSHLSSSLQGLWTIRAYKAEERCQELFDAHQDLHSEAWFLFLTTSRWFAVRLDAICAMFVIIVAFGSLILAKTLD
  AGQVGLALSYALTLMGMFQWCVRQSAEVENMMISVERVIEYTDLEKEAPWEYQKRPPPAWPHEGVIIFDNVNFMY
  SPGGPLVLKHLTALIKSQEKVGIVGRTGAGKSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQEPV
  LFTGTMRKNLDPFNEHTDEELWNALQEVQLKETIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILRKNQILII
  DEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNKESLFYKMVQQ
  LGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPSTLTIFETAL

• Structural information:
  • Protein Domains: (92..37-)
    type-1 (/note="ABC-transmembrane)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00441-)
    (410..63-)
    1 (/note="ABC-transporter)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00434-)
    (714..100-)
    type-1 (/note="ABC-transmembrane)
    (-)
  • Interpro: IPR003593  IPR011527  IPR036640  IPR003439  IPR017871   IPR030240  IPR027417  
  • Prosite: PS50929 PS00211 PS50893
  • STRING: ENSP00000366084
• Other Databases: GeneCards:  ABCC4  Malacards:  ABCC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0042910	xenobiotic transmembrane transporter activity	IMP	molecular function
GO:0015562	efflux transmembrane transporter activity	IMP	molecular function
GO:0140115	export across plasma membrane	IMP	biological process
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0098591	external side of apical plasma membrane	ISS	cellular component
GO:0098591	external side of apical plasma membrane	ISS	cellular component
GO:0098591	external side of apical plasma membrane	ISS	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0042626	ATPase-coupled transmembrane transporter activity	IBA	molecular function
GO:0055085	transmembrane transport	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0042626	ATPase-coupled transmembrane transporter activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016887	ATPase activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0032310	prostaglandin secretion	IDA	biological process
GO:0031088	platelet dense granule membrane	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0060271	cilium assembly	IMP	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0015662	ion transmembrane transporter activity, phosphorylative mechanism	TAS	molecular function
GO:0055085	transmembrane transport	TAS	biological process
GO:0031088	platelet dense granule membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0098591	external side of apical plasma membrane	IEA	cellular component
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0042908	xenobiotic transport	IEA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0016404	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04024	cAMP signaling pathway
hsa04976	Bile secretion
hsa02010	ABC transporters
hsa01523	Antifolate resistance

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq