• Gene id: 10256

Gene Summary

• Gene Symbol: CNKSR1   Gene   UCSC   Ensembl
• Aliases: CNK, CNK1
• Gene name: connector enhancer of kinase suppressor of Ras 1
• Alternate names: connector enhancer of kinase suppressor of ras 1, CNK homolog protein 1, connector enhancer of KSR 1, connector enhancer of KSR-like,
• Gene location: 1p36.11 (26177490: 26189883)     Exons: 21     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein containing several motifs involved in protein-protein interaction, including PDZ, PH (Pleckstrin homology), and SAM (sterile alpha motif) domains. The encoded protein acts as a scaffold component for receptor tyrosine kinase si
• OMIM: 603272

Protein Summary

• Protein general information: Q969H4  
  • Name: Connector enhancer of kinase suppressor of ras 1 (Connector enhancer of KSR 1) (CNK homolog protein 1) (CNK1) (hCNK1) (Connector enhancer of KSR like)
  • Length: 720  
  • Mass: 79706
• Sequence:

  MEPVETWTPGKVATWLRGLDDSLQDYPFEDWQLPGKNLLQLCPQSLEALAVRSLGHQELILGGVEQLQALSSRLQ
  TENLQSLTEGLLGATHDFQSIVQGCLGDCAKTPIDVLCAAVELLHEADALLFWLSRYLFSHLNDFSACQEIRDLL
  EELSQVLHEDGPAAEKEGTVLRICSHVAGICHNILVCCPKELLEQKAVLEQVQLDSPLGLEIHTTSNCQHFVSQV
  DTQVPTDSRLQIQPGDEVVQINEQVVVREERDMVGWPRKNMVRELLREPAGLSLVLKKIPIPETPPQTPPQVLDS
  PHQRSPSLSLAPLSPRAPSEDVFAFDLSSNPSPGPSPAWTDSASLGPEPLPIPPEPPAILPAGVAGTPGLPESPD
  KSPVGRKKSKGLATRLSRRRVSCRELGRPDCDGWLLLRKAPGGFMGPRWRRRWFVLKGHTLYWYRQPQDEKAEGL
  INVSNYSLESGHDQKKKYVFQLTHDVYKPFIFAADTLTDLSMWVRHLITCISKYQSPGRAPPPREEDCYSETEAE
  DPDDEAGSHSASPSPAQAGSPLHGDTSPAATPTQRSPRTSFGSLTDSSEEALEGMVRGLRQGGVSLLGQPQPLTQ
  EQWRSSFMRRNRDPQLNERVHRVRALQSTLKAKLQELQVLEEVLGDPELTGEKFRQWKEQNRELYSEGLGAWGVA
  QAEGSSHILTSDSTEQSPHSLPSDPEEHSHLCPLTSESSLRPPDL

• Structural information:
  • Protein Domains: (7..7-)
    (/note="SAM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00184-)
    (78..16-)
    (/note="CRIC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00621-)
    (196..28-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (403..-)
  • Interpro: IPR017874  IPR001478  IPR011993  IPR001849  IPR001660   IPR013761  
  • Prosite: PS51290 PS50106 PS50003 PS50105
  • PDB: 1WWV
  • PDBsum: 1WWV
  • STRING: ENSP00000363371
• Other Databases: GeneCards:  CNKSR1  Malacards:  CNKSR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	TAS	biological process
GO:0005911	cell-cell junction	TAS	cellular component
GO:0005938	cell cortex	IDA	cellular component
GO:0030674	protein-macromolecule adaptor activity	IDA	molecular function
GO:0007266	Rho protein signal transduction	IPI	biological process
GO:0007266	Rho protein signal transduction	IPI	biological process
GO:0007265	Ras protein signal transduction	IPI	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
P06959	CCKR signaling map

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881