• Gene id: 10253

Gene Summary

• Gene Symbol: SPRY2   Gene   UCSC   Ensembl
• Aliases: IGAN3, hSPRY2
• Gene name: sprouty RTK signaling antagonist 2
• Alternate names: protein sprouty homolog 2,
• Gene location: 13q31.1 (80341125: 80335975)     Exons: 4     NC_000013.11
• Gene summary(Entrez): This gene encodes a protein belonging to the sprouty family. The encoded protein contains a carboxyl-terminal cysteine-rich domain essential for the inhibitory activity on receptor tyrosine kinase signaling proteins and is required for growth factor stimu
• OMIM: 116960

Protein Summary

• Protein general information: O43597  
  • Name: Protein sprouty homolog 2 (Spry 2)
  • Length: 315  
  • Mass: 34688
• Sequence:

  MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPTVVPRPGLKPAPRPST
  QHKHERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSGSRSSTRTSTSSSSSEQRLLGSSFSSGPVADGII
  RVQPKSELKPGELKPLSKEDLGLHAYRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVCCVKGL
  FYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVC
  CKVPTVPPRNFEKPT

• Structural information:
  • Protein Domains: (177..29-)
    (/note="SPR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00572"-)
  • Interpro: IPR007875  IPR030780  
  • Prosite: PS51227
  • PDB: 3BUM 3OB1 5HKY 5HKZ 5HL0
  • PDBsum: 3BUM 3OB1 5HKY 5HKZ 5HL0
  • STRING: ENSP00000366306
• Other Databases: GeneCards:  SPRY2  Malacards:  SPRY2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0048513	animal organ development	IBA	biological process
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	IBA	biological process
GO:0043407	negative regulation of MAP kinase activity	IBA	biological process
GO:0046580	negative regulation of Ras protein signal transduction	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0009966	regulation of signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0045595	regulation of cell differentiation	IEA	biological process
GO:0046580	negative regulation of Ras protein signal transduction	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060541	respiratory system development	IEA	biological process
GO:0060449	bud elongation involved in lung branching	IEA	biological process
GO:0060437	lung growth	IEA	biological process
GO:0048754	branching morphogenesis of an epithelial tube	IEA	biological process
GO:0045165	cell fate commitment	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0042472	inner ear morphogenesis	IEA	biological process
GO:0034260	negative regulation of GTPase activity	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0000132	establishment of mitotic spindle orientation	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0060425	lung morphogenesis	IEA	biological process
GO:0051387	negative regulation of neurotrophin TRK receptor signaling pathway	IEA	biological process
GO:0046580	negative regulation of Ras protein signal transduction	IEA	biological process
GO:0043407	negative regulation of MAP kinase activity	IEA	biological process
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0031345	negative regulation of cell projection organization	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007605	sensory perception of sound	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:1900747	negative regulation of vascular endothelial growth factor signaling pathway	IDA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0031345	negative regulation of cell projection organization	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005856	cytoskeleton	ISS	cellular component
GO:0016020	membrane	ISS	cellular component
GO:0070373	negative regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0030291	protein serine/threonine kinase inhibitor activity	IC	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0010801	negative regulation of peptidyl-threonine phosphorylation	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IMP	biological process
GO:0032587	ruffle membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:1990752	microtubule end	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0051897	positive regulation of protein kinase B signaling	IMP	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	ISS	biological process
GO:1902747	negative regulation of lens fiber cell differentiation	ISS	biological process
GO:0043539	protein serine/threonine kinase activator activity	IMP	molecular function
GO:0070373	negative regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010719	negative regulation of epithelial to mesenchymal transition	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881