Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 10252
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary
Gene Symbol SPRY1   Gene   UCSC   Ensembl
Aliases hSPRY1
Gene name sprouty RTK signaling antagonist 1
Alternate names protein sprouty homolog 1, sprouty homolog 1, antagonist of FGF signaling, sprouty, Drosophila, homolog of, 1 (antagonist of FGF signaling), spry-1,
Gene location 4q28.1 (123396794: 123403759)     Exons: 5     NC_000004.12
OMIM 602465

Protein Summary
Protein general information O43609  

Name: Protein sprouty homolog 1 (Spry 1)

Length: 319  Mass: 35122

Sequence MDPQNQHGSGSSLVVIQQPSLDSRQRLDYEREIQPTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPRQEKHE
RTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSPPTRPVPGHRS
ERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKCGECTAPRTLPSCLACNRQCLCSAESMVEYGTCMCLV
KGIFYHCSNDDEGDSYSDNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCLKLCRRCYDWIHRPGCRCKNS
NTVYCKLESCPSRGQGKPS
Structural information
Protein Domains
 (183..29-)
(/note="SPR-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00572"-)
Interpro:  IPR007875  IPR030783  
Prosite:   PS51227
MINT:  
STRING:   ENSP00000481675
Other Databases GeneCards:  SPRY1  Malacards:  SPRY1

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0048513 animal organ development
 IBA biological process
GO:0005829 cytosol
 IBA cellular component
GO:0046580 negative regulation of Ra
s protein signal transduc
tion
 IBA biological process
GO:0043407 negative regulation of MA
P kinase activity
 IBA biological process
GO:0040037 negative regulation of fi
broblast growth factor re
ceptor signaling pathway
 IBA biological process
GO:0008285 negative regulation of ce
ll population proliferati
on
 IEA biological process
GO:0001759 organ induction
 IEA biological process
GO:0007275 multicellular organism de
velopment
 IEA biological process
GO:0009966 regulation of signal tran
sduction
 IEA biological process
GO:0016020 membrane
 IEA cellular component
GO:0046580 negative regulation of Ra
s protein signal transduc
tion
 IEA biological process
GO:0070373 negative regulation of ER
K1 and ERK2 cascade
 IEA biological process
GO:0007275 multicellular organism de
velopment
 IEA biological process
GO:0016020 membrane
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0040037 negative regulation of fi
broblast growth factor re
ceptor signaling pathway
 IMP biological process
GO:0005886 plasma membrane
 TAS cellular component
GO:0042059 negative regulation of ep
idermal growth factor rec
eptor signaling pathway
 TAS biological process
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0060940 epithelial to mesenchymal
transition involved in c
ardiac fibroblast develop
ment
 IEA biological process
GO:0070373 negative regulation of ER
K1 and ERK2 cascade
 IEA biological process
GO:0051387 negative regulation of ne
urotrophin TRK receptor s
ignaling pathway
 IEA biological process
GO:0046580 negative regulation of Ra
s protein signal transduc
tion
 IEA biological process
GO:0043407 negative regulation of MA
P kinase activity
 IEA biological process
GO:0040037 negative regulation of fi
broblast growth factor re
ceptor signaling pathway
 IEA biological process
GO:0001759 organ induction
 IEA biological process
GO:0005829 cytosol
 IEA cellular component
GO:0060449 bud elongation involved i
n lung branching
 IEA biological process
GO:0034260 negative regulation of GT
Pase activity
 IEA biological process
GO:0008285 negative regulation of ce
ll population proliferati
on
 IEA biological process
GO:0001657 ureteric bud development
 IEA biological process
GO:0001656 metanephros development
 IEA biological process
GO:0000132 establishment of mitotic
spindle orientation
 IEA biological process
GO:0005829 cytosol
 ISS cellular component
GO:0070373 negative regulation of ER
K1 and ERK2 cascade
 ISS biological process
GO:0060940 epithelial to mesenchymal
transition involved in c
ardiac fibroblast develop
ment
 ISS biological process
GO:0016020 membrane
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005794 Golgi apparatus
 IDA cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0030512 negative regulation of tr
ansforming growth factor
beta receptor signaling p
athway
 ISS biological process
GO:1902747 negative regulation of le
ns fiber cell differentia
tion
 ISS biological process
GO:0070373 negative regulation of ER
K1 and ERK2 cascade
 ISS biological process
GO:0010719 negative regulation of ep
ithelial to mesenchymal t
ransition
 ISS biological process

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
13 (5 controls,
8 cases)
 Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract