• Gene id: 10251

Gene Summary

• Gene Symbol: SPRY3   Gene   UCSC   Ensembl
• Aliases: spry-3
• Gene name: sprouty RTK signaling antagonist 3
• Alternate names: protein sprouty homolog 3, antagonist of FGF signaling, sprouty homolog 3,
• Gene location: Xq28 and Yq12 (155612564: 155782458)     Exons: 3     NC_000023.11

Protein Summary

• Protein general information: O43610  
  • Name: Protein sprouty homolog 3 (Spry 3)
  • Length: 288  
  • Mass: 31222
  • Tissue specificity: Widely expressed; particularly in the fetal tissues.
• Sequence:

  MDAAVTDDFQQILPIEQLRSTHASNDYVERPPAPCKQALSSPSLIVQTHKSDWSLATMPTSLPRSLSQCHQLQPL
  PQHLSQSSIASSMSHSTTASDQRLLASITPSPSGQSIIRTQPGAGVHPKADGALKGEAEQSAGHPSEHLFICEEC
  GRCKCVPCTAARPLPSCWLCNQRCLCSAESLLDYGTCLCCVKGLFYHCSTDDEDNCADEPCSCGPSSCFVRWAAM
  SLISLFLPCLCCYLPTRGCLHLCQQGYDSLRRPGCRCKRHTNTVCRKISSGSAPFPKAQEKSV

• Structural information:
  • Protein Domains: (154..26-)
    (/note="SPR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00572"-)
  • Interpro: IPR007875  IPR030786  
  • Prosite: PS51227
  • STRING: ENSP00000302978
• Other Databases: GeneCards:  SPRY3  Malacards:  SPRY3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0048513	animal organ development	IBA	biological process
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	IBA	biological process
GO:0043407	negative regulation of MAP kinase activity	IBA	biological process
GO:0046580	negative regulation of Ras protein signal transduction	IBA	biological process
GO:0061564	axon development	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0009966	regulation of signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007275	multicellular organism development	NAS	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R