• Gene id: 1025

Gene Summary

• Gene Symbol: CDK9   Gene   UCSC   Ensembl
• Aliases: C-2k, CDC2L4, CTK1, PITALRE, TAK
• Gene name: cyclin dependent kinase 9
• Alternate names: cyclin-dependent kinase 9, CDC2-related kinase, cell division cycle 2-like protein kinase 4, cell division protein kinase 9, serine/threonine protein kinase PITALRE, tat-associated kinase complex catalytic subunit,
• Gene location: 9q34.11 (127785537: 127790781)     Exons: 7     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and known as important cell cycle regulators. This kina
• OMIM: 603251

Protein Summary

• Protein general information: P50750  
  • Name: Cyclin dependent kinase 9 (EC 2.7.11.22) (EC 2.7.11.23) (C 2K) (Cell division cycle 2 like protein kinase 4) (Cell division protein kinase 9) (Serine/threonine protein kinase PITALRE) (Tat associated kinase complex catalytic subunit)
  • Length: 372  
  • Mass: 42,778
• Sequence:

  MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKH
  ENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDM
  KAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTR
  SPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP
  AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

• Structural information:
  • Protein Domains: Protein (19-315)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 1PF6 3BLH 3BLQ 3BLR 3LQ5 3MI9 3MIA 3MY1 3TN8 3TNH 3TNI 4BCF 4BCG 4BCH 4BCI 4BCJ 4EC8 4EC9 4IMY 4OGR 4OR5 5L1Z
  • PDBsum: 1PF6 3BLH 3BLQ 3BLR 3LQ5 3MI9 3MIA 3MY1 3TN8 3TNH 3TNI 4BCF 4BCG 4BCH 4BCI 4BCJ 4EC8 4EC9 4IMY 4OGR 4OR5 5L1Z
  • DIP: 29016
  • STRING: ENSP00000362361
• Other Databases: GeneCards:  CDK9  Malacards:  CDK9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding	IEA	molecular function
GO:0001223	transcription coactivator binding	IPI	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003682	chromatin binding	ISS	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006281	DNA repair	IEA	biological process
GO:0006282	regulation of DNA repair	IDA	biological process
GO:0006366	transcription from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0008023	transcription elongation factor complex	IDA	cellular component
GO:0008024	cyclin/CDK positive transcription elongation factor complex	IDA	cellular component
GO:0008024	cyclin/CDK positive transcription elongation factor complex	IDA	cellular component
GO:0008283	cell proliferation	TAS	biological process
GO:0008353	RNA polymerase II carboxy-terminal domain kinase activity	IDA	molecular function
GO:0010613	positive regulation of cardiac muscle hypertrophy	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016301	kinase activity	TAS	molecular function
GO:0016605	PML body	IDA	cellular component
GO:0031056	regulation of histone modification	IDA	biological process
GO:0031297	replication fork processing	IDA	biological process
GO:0033129	positive regulation of histone phosphorylation	IMP	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042795	snRNA transcription from RNA polymerase II promoter	TAS	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	TAS	biological process
GO:0050434	positive regulation of viral transcription	TAS	biological process
GO:0051147	regulation of muscle cell differentiation	IMP	biological process
GO:0071157	negative regulation of cell cycle arrest	IDA	biological process
GO:0071345	cellular response to cytokine stimulus	IDA	biological process
GO:0097322	7SK snRNA binding	IDA	molecular function
GO:1900364	negative regulation of mRNA polyadenylation	IMP	biological process
GO:1903839	positive regulation of mRNA 3'-UTR binding	IDA	biological process
GO:2001168	positive regulation of histone H2B ubiquitination	IMP	biological process
GO:0007346	regulation of mitotic cell cycle	IMP	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding	IEA	molecular function
GO:0001223	transcription coactivator binding	IPI	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0003682	chromatin binding	ISS	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006281	DNA repair	IEA	biological process
GO:0006282	regulation of DNA repair	IDA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006366	transcription from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0008023	transcription elongation factor complex	TAS	cellular component
GO:0008023	transcription elongation factor complex	IDA	cellular component
GO:0008024	cyclin/CDK positive transcription elongation factor complex	IEA	cellular component
GO:0008024	cyclin/CDK positive transcription elongation factor complex	IDA	cellular component
GO:0008024	cyclin/CDK positive transcription elongation factor complex	IDA	cellular component
GO:0008134	transcription factor binding	IEA	molecular function
GO:0008283	cell proliferation	TAS	biological process
GO:0008353	RNA polymerase II carboxy-terminal domain kinase activity	IEA	molecular function
GO:0008353	RNA polymerase II carboxy-terminal domain kinase activity	IDA	molecular function
GO:0010613	positive regulation of cardiac muscle hypertrophy	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016605	PML body	IEA	cellular component
GO:0016605	PML body	IDA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0017069	snRNA binding	IEA	molecular function
GO:0031056	regulation of histone modification	IDA	biological process
GO:0031297	replication fork processing	IDA	biological process
GO:0033129	positive regulation of histone phosphorylation	IEA	biological process
GO:0033129	positive regulation of histone phosphorylation	IMP	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042795	snRNA transcription from RNA polymerase II promoter	TAS	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0044212	transcription regulatory region DNA binding	IEA	molecular function
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	TAS	biological process
GO:0050434	positive regulation of viral transcription	TAS	biological process
GO:0051147	regulation of muscle cell differentiation	IMP	biological process
GO:0071157	negative regulation of cell cycle arrest	IDA	biological process
GO:0071345	cellular response to cytokine stimulus	IDA	biological process
GO:0097322	7SK snRNA binding	IDA	molecular function
GO:1900364	negative regulation of mRNA polyadenylation	IMP	biological process
GO:1903839	positive regulation of mRNA 3'-UTR binding	IDA	biological process
GO:2001168	positive regulation of histone H2B ubiquitination	IEA	biological process
GO:2001168	positive regulation of histone H2B ubiquitination	IMP	biological process
GO:0007346	regulation of mitotic cell cycle	IMP	biological process
GO:0001223	transcription coactivator binding	IPI	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003682	chromatin binding	ISS	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006282	regulation of DNA repair	IDA	biological process
GO:0006366	transcription from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0008023	transcription elongation factor complex	TAS	cellular component
GO:0008023	transcription elongation factor complex	IDA	cellular component
GO:0008024	cyclin/CDK positive transcription elongation factor complex	IDA	cellular component
GO:0008024	cyclin/CDK positive transcription elongation factor complex	IDA	cellular component
GO:0008283	cell proliferation	TAS	biological process
GO:0008353	RNA polymerase II carboxy-terminal domain kinase activity	IDA	molecular function
GO:0016020	membrane	IDA	cellular component
GO:0016301	kinase activity	TAS	molecular function
GO:0016605	PML body	IDA	cellular component
GO:0031056	regulation of histone modification	IDA	biological process
GO:0031297	replication fork processing	IDA	biological process
GO:0033129	positive regulation of histone phosphorylation	IMP	biological process
GO:0042795	snRNA transcription from RNA polymerase II promoter	TAS	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	TAS	biological process
GO:0050434	positive regulation of viral transcription	TAS	biological process
GO:0051147	regulation of muscle cell differentiation	IMP	biological process
GO:0071157	negative regulation of cell cycle arrest	IDA	biological process
GO:0071345	cellular response to cytokine stimulus	IDA	biological process
GO:0097322	7SK snRNA binding	IDA	molecular function
GO:1900364	negative regulation of mRNA polyadenylation	IMP	biological process
GO:1903839	positive regulation of mRNA 3'-UTR binding	IDA	biological process
GO:2001168	positive regulation of histone H2B ubiquitination	IMP	biological process
GO:0007346	regulation of mitotic cell cycle	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer

Diseases

Associated diseases	References
Male factor infertility	MIK: 19426592
Azoospermia	MIK: 19426592
Azoospermia	MIK: 19426592
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19426592	Azoospermia				Male infertility	CDC10 CDC7L1 CDK9 CDC20 and CLK3
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)