• Gene id: 10249

Gene Summary

• Gene Symbol: GLYAT   Gene   UCSC   Ensembl
• Aliases: ACGNAT, CAT, GAT
• Gene name: glycine-N-acyltransferase
• Alternate names: glycine N-acyltransferase, AAc, HRP-1(CLP), acyl-CoA:glycine N-acyltransferase, aralkyl acyl-CoA N-acyltransferase, aralkyl acyl-CoA:amino acid N-acyltransferase, aralkyl-CoA N-acyltransferase, benzoyl-coenzyme A:glycine N-acyltransferase, epididymis secretory sp,
• Gene location: 11q12.1 (1349417: 1335277)     Exons: 16     NC_000001.11
• Gene summary(Entrez): The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoA's. Two transcript variants encoding different isoform
• OMIM: 607424

Protein Summary

• Protein general information: Q6IB77  
  • Name: Glycine N acyltransferase (EC 2.3.1.13) (Acyl CoA:glycine N acyltransferase) (AAc) (Aralkyl acyl CoA N acyltransferase) (Aralkyl acyl CoA:amino acid N acyltransferase) (Benzoyl coenzyme A:glycine N acyltransferase) (Glycine N benzoyltransferase) (EC 2.3.1
  • Length: 296  
  • Mass: 33924
  • Tissue specificity: Predominantly expressed in liver (at protein level) and kidney. Down-regulated in hepatocellular carcinoma and other liver cancers. {ECO
• Sequence:

  MMLPLQGAQMLQMLEKSLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLDHYTNT
  YQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAKELTPFLLKS
  KILSPNGGKPKAINQEMFKLSSMDVTHAHLVNKFWHFGGNERSQRFIERCIQTFPTCCLLGPEGTPVCWDLMDQT
  GEMRMAGTLPEYRLHGLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQHVPIPRSWNQWNCVPL

• Structural information:
  • Interpro: IPR016181  IPR010313  IPR013652  IPR015938  
  • STRING: ENSP00000484592
• Other Databases: GeneCards:  GLYAT  Malacards:  GLYAT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0016410	N-acyltransferase activity	IBA	molecular function
GO:0047961	glycine N-acyltransferase activity	IBA	molecular function
GO:0006544	glycine metabolic process	IBA	biological process
GO:0047962	glycine N-benzoyltransferase activity	IBA	molecular function
GO:0047962	glycine N-benzoyltransferase activity	ISS	molecular function
GO:0032787	monocarboxylic acid metabolic process	ISS	biological process
GO:0006544	glycine metabolic process	ISS	biological process
GO:0005739	mitochondrion	ISS	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0047961	glycine N-acyltransferase activity	IEA	molecular function
GO:0009636	response to toxic substance	IEA	biological process
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016746	transferase activity, transferring acyl groups	TAS	molecular function
GO:0005739	mitochondrion	TAS	cellular component
GO:0006637	acyl-CoA metabolic process	TAS	biological process
GO:0009636	response to toxic substance	TAS	biological process
GO:0047962	glycine N-benzoyltransferase activity	IEA	molecular function
GO:0047961	glycine N-acyltransferase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:1901787	benzoyl-CoA metabolic process	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0047961	glycine N-acyltransferase activity	IDA	molecular function
GO:0006544	glycine metabolic process	IDA	biological process
GO:0047962	glycine N-benzoyltransferase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00360	Phenylalanine metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)