• Gene id: 10247

Gene Summary

• Gene Symbol: RIDA   Gene   UCSC   Ensembl
• Aliases: HRSP12, P14.5, PSP, UK114, hp14.5
• Gene name: reactive intermediate imine deaminase A homolog
• Alternate names: 2-iminobutanoate/2-iminopropanoate deaminase, 14.5 kDa translational inhibitor protein, UK114 antigen homolog, heat-responsive protein 12, perchloric acid-soluble protein, ribonuclease UK114, translation inhibitor L-PSP ribonuclease, translational inhibitor p14.,
• Gene location: 8q22.2 (98117170: 98102343)     Exons: 48     NC_000008.11
• OMIM: 602487

Protein Summary

• Protein general information: P52758  
  • Name: 2 iminobutanoate/2 iminopropanoate deaminase (EC 3.5.99.10) (14.5 kDa translational inhibitor protein) (hp14.5) (p14.5) (Heat responsive protein 12) (Reactive intermediate imine deaminase A homolog) (Translation inhibitor L PSP ribonuclease) (UK114 antige
  • Length: 137  
  • Mass: 14494
  • Tissue specificity: Expressed predominantly in liver and kidney. Lower levels in lung and brain. {ECO
• Sequence:

  MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAGCDFTN
  VVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGPLTTASL

• Structural information:
  • Interpro: IPR006056  IPR019897  IPR035959  IPR006175  
  • Prosite: PS01094
  • PDB: 1ONI
  • PDBsum: 1ONI
  • STRING: ENSP00000254878
• Other Databases: GeneCards:  RIDA  Malacards:  RIDA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901565	organonitrogen compound catabolic process	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0019239	deaminase activity	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:1901565	organonitrogen compound catabolic process	IDA	biological process
GO:0003729	mRNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0019239	deaminase activity	IDA	molecular function
GO:0006402	mRNA catabolic process	IDA	biological process
GO:0061157	mRNA destabilization	IDA	biological process
GO:0017148	negative regulation of translation	ISS	biological process
GO:0005759	mitochondrial matrix	ISS	cellular component
GO:0005777	peroxisome	ISS	cellular component
GO:0016892	endoribonuclease activity, producing 3'-phosphomonoesters	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0019239	deaminase activity	TAS	molecular function
GO:0019518	L-threonine catabolic process to glycine	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0001822	kidney development	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0017148	negative regulation of translation	IEA	biological process
GO:0033993	response to lipid	IEA	biological process
GO:0036041	long-chain fatty acid binding	IEA	molecular function
GO:0043167	ion binding	IEA	molecular function
GO:0050680	negative regulation of epithelial cell proliferation	IEA	biological process
GO:0070314	G1 to G0 transition	IEA	biological process
GO:1902074	response to salt	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0007420	brain development	IEA	biological process
GO:0016892	endoribonuclease activity, producing 3'-phosphomonoesters	IEA	molecular function
GO:0030324	lung development	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0046914	transition metal ion binding	IEA	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881