• Gene id: 10237

Gene Summary

• Gene Symbol: SLC35B1   Gene   UCSC   Ensembl
• Aliases: UGTREL1
• Gene name: solute carrier family 35 member B1
• Alternate names: solute carrier family 35 member B1, UDP-galactose transporter related, UDP-galactose transporter-related protein 1,
• Gene location: 17q21.33 (34155621: 34018642)     Exons: 15     NC_000006.12
• Gene summary(Entrez): This gene encodes a nucleotide sugar transporter which is a member of solute carrier family 35. The transporters in this family are highly conserved hydrophobic proteins with multiple transmembrane domains. Alternative splicing results in multiple transcr
• OMIM: 610790

Protein Summary

• Protein general information: P78383  
  • Name: Solute carrier family 35 member B1 (UDP galactose transporter related protein 1) (UGTrel1) (hUGTrel1)
  • Length: 322  
  • Mass: 35760
• Sequence:

  MASSSSLVPDRLRLPLCFLGVFVCYFYYGILQEKITRGKYGEGAKQETFTFALTLVFIQCVINAVFAKILIQFFD
  TARVDRTRSWLYAACSISYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAG
  VALFMYKPKKVVGIEEHTVGYGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTLLLGMGILFTGE
  LWEFLSFAERYPAIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT
  VLVFLGLGLDAKFGKGAKKTSH

• Structural information:
  • Interpro: IPR013657  
  • STRING: ENSP00000240333
• Other Databases: GeneCards:  SLC35B1  Malacards:  SLC35B1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072334	UDP-galactose transmembrane transport	IBA	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0030173	integral component of Golgi membrane	IBA	cellular component
GO:0022857	transmembrane transporter activity	IBA	molecular function
GO:0005460	UDP-glucose transmembrane transporter activity	IBA	molecular function
GO:0005459	UDP-galactose transmembrane transporter activity	IBA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005459	UDP-galactose transmembrane transporter activity	TAS	molecular function
GO:0043231	intracellular membrane-bounded organelle	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0015786	UDP-glucose transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)