• Gene id: 10234

Gene Summary

• Gene Symbol: LRRC17   Gene   UCSC   Ensembl
• Aliases: P37NB
• Gene name: leucine rich repeat containing 17
• Alternate names: leucine-rich repeat-containing protein 17, 37 kDa leucine-rich repeat (LRR) protein,
• Gene location: 7q22.1 (102912999: 102945110)     Exons: 6     NC_000007.14
• OMIM: 602887

Protein Summary

• Protein general information: Q8N6Y2  
  • Name: Leucine rich repeat containing protein 17 (p37NB)
  • Length: 441  
  • Mass: 51800
  • Tissue specificity: Expressed in osteoblast cell lines. Well expressed in ovary, heart, pancreas, skeletal muscle, lung, and fetal kidney and lung and only at the basal levels in the other tissues examined including adult kidney. More expressed in S-type
• Sequence:

  MRVVTIVILLCFCKAAELRKASPGSVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYLHEKYLDCQERKLVYV
  LPGWPQDLLHMLLARNKIRTLKNNMFSKFKKLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQIKVLTEEVFI
  YTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQ
  VSGRPPVIKPEVDSTFCHNYVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHELKKLNLS
  SNGIEFIDPAAFLGLTHLEELDLSNNSLQNFDYGVLEDLYFLKLLWLRDNPWRCDYNIHYLYYWLKHHYNVHFNG
  LECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDEWEKKHRDHTAKKQSVIITIVG

• Structural information:
  • Protein Domains: (163..21-)
    (/note="LRRCT-1)
    (225..26-)
    (/note="LRRNT-)
    (350..40-)
    (/note="LRRCT-2")
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  
  • Prosite: PS51450
  • STRING: ENSP00000344242
• Other Databases: GeneCards:  LRRC17  Malacards:  LRRC17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0031012	extracellular matrix	IBA	cellular component
GO:0048539	bone marrow development	ISS	biological process
GO:0045671	negative regulation of osteoclast differentiation	ISS	biological process
GO:0005615	extracellular space	ISS	cellular component
GO:0001649	osteoblast differentiation	ISS	NOT|biological process
GO:0033687	osteoblast proliferation	ISS	NOT|biological process
GO:0001503	ossification	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0048539	bone marrow development	IEA	biological process
GO:0045671	negative regulation of osteoclast differentiation	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0031012	extracellular matrix	IBA	cellular component
GO:0048539	bone marrow development	ISS	biological process
GO:0045671	negative regulation of osteoclast differentiation	ISS	biological process
GO:0005615	extracellular space	ISS	cellular component
GO:0001649	osteoblast differentiation	ISS	NOT|biological process
GO:0033687	osteoblast proliferation	ISS	NOT|biological process
GO:0001503	ossification	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0048539	bone marrow development	IEA	biological process
GO:0045671	negative regulation of osteoclast differentiation	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881