|
Gene id |
102288414 |
| Gene Summary Protein Summary Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
C11orf98 Gene UCSC Ensembl |
|
Aliases |
C11orf48 |
|
Gene name |
chromosome 11 open reading frame 98 |
|
Alternate names |
uncharacterized protein C11orf98, |
|
Gene location |
11q12.3 (62665215: 62662816) Exons: 11 NC_000011.10
|
|
Gene summary(Entrez) |
This gene shares three exons in common with another gene, LBH domain containing 1 (GeneID:79081), but the encoded protein uses a reading frame that is different from that of the LBH domain containing 1 gene. [provided by RefSeq, Nov 2017]
|
Protein Summary
|
| Protein general information
| E9PRG8
Name: Uncharacterized protein C11orf98
Length: 123 Mass: 14234
|
| Sequence |
MGAPGGKINRPRTELKKKLFKRRRVLNRERRLRHRVVGAVIDQGLITRHHLKKRASSARANITLSGKKRRKLLQQ
IRLAQKEKTAMEVEAPSKPARTSEPQLKRQKKTKAPQDVEMKDLEDES
|
| Structural information |
|
| Other Databases |
GeneCards: C11orf98 Malacards: C11orf98 |
|
| Associated diseases |
References |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos
permia
|
|
|
19 (6 controls
, 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
|