• Gene id: 10227

Gene Summary

• Gene Symbol: MFSD10   Gene   UCSC   Ensembl
• Aliases: TETRAN, TETTRAN
• Gene name: major facilitator superfamily domain containing 10
• Alternate names: major facilitator superfamily domain-containing protein 10, tetracycline transporter-like protein,
• Gene location: 4p16.3 (2934858: 2930555)     Exons: 12     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the major facilitator superfamily of transporter proteins. The encoded protein likely functions in efflux of organic anions, including the non-steroidal anti-inflammatory drugs indomethacin and diclofenac. Alternatively splic
• OMIM: 610977

Protein Summary

• Protein general information: Q14728  
  • Name: Major facilitator superfamily domain containing protein 10 (Tetracycline transporter like protein)
  • Length: 455  
  • Mass: 48339
• Sequence:

  MGWGGGGGCTPRPPIHQQPPERRVVTVVFLGLLLDLLAFTLLLPLLPGLLESHGRAHDPLYGSWQGGVDWFATAI
  GMPVEKRYNSVLFGGLIGSAFSVLQFLCAPLTGATSDCLGRRPVMLLCLMGVATSYAVWATSRSFAAFLASRLIG
  GISKGNVSLSTAIVADLGSPLARSQGMAVIGVAFSLGFTLGPMLGASLPLEMAPWFALLFAASDLLFIFCFLPET
  LPLEKRAPSIALGFRDAADLLSPLALLRFSAVARGQDPPSGDRLSSLRRLGLVYFLYLFLFSGLEYTLSFLTHQR
  FQFSSLQQGKMFFLIGLTMATIQGAYARRIHPGGEVAAVKRALLLLVPAFLLIGWGRSLPVLGLGLLLYSFAAAV
  VVPCLSSVVAGYGSPGQKGTVMGTLRSLGALARAAGPLVAASVYWLAGAQACFTTWSGLFLLPFFLLQKLSYPAQ
  TLKAE

• Structural information:
  • Interpro: IPR011701  IPR020846  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000332646
• Other Databases: GeneCards:  MFSD10  Malacards:  MFSD10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031526	brush border membrane	IBA	cellular component
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008493	tetracycline transmembrane transporter activity	TAS	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	IDA	cellular component
GO:0008514	organic anion transmembrane transporter activity	IDA	molecular function
GO:0043252	sodium-independent organic anion transport	IDA	biological process
GO:0005637	nuclear inner membrane	IEA	cellular component
GO:0031526	brush border membrane	IEA	cellular component
GO:0005637	nuclear inner membrane	IEA	cellular component
GO:0015904	tetracycline transmembrane transport	IEA	biological process
GO:0005637	nuclear inner membrane	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881