• Gene id: 10223

Gene Summary

• Gene Symbol: GPA33   Gene   UCSC   Ensembl
• Aliases: A33
• Gene name: glycoprotein A33
• Alternate names: cell surface A33 antigen, glycoprotein A33 (transmembrane), transmembrane glycoprotein A33,
• Gene location: 1q24.1 (167090391: 167052835)     Exons: 8     NC_000001.11
• Gene summary(Entrez): The glycoprotein encoded by this gene is a cell surface antigen that is expressed in greater than 95% of human colon cancers. The open reading frame encodes a 319-amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosyla
• OMIM: 605250

Protein Summary

• Protein general information: Q99795  
  • Name: Cell surface A33 antigen (Glycoprotein A33)
  • Length: 319  
  • Mass: 35632
  • Tissue specificity: Expressed in normal gastrointestinal epithelium and in 95% of colon cancers.
• Sequence:

  MVGKMWPVLWTLCAVRVTVDAISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFS
  NKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEG
  ETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNIT
  VAVRSPSMNVALYVGIAVGVVAALIIIGIIIYCCCCRGKDDNTEDKEDARPNREAYEEPPEQLRELSREREEEDD
  YRQEEQRSTGRESPDHLDQ

• Structural information:
  • Protein Domains: (22..13-)
    (/note="Ig-like-V-type)
    (140..22-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR042474  IPR007110  IPR036179  IPR013783  IPR003599   IPR003598  IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000356842
• Other Databases: GeneCards:  GPA33  Malacards:  GPA33

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray