• Gene id: 10221

Gene Summary

• Gene Symbol: TRIB1   Gene   UCSC   Ensembl
• Aliases: C8FW, GIG-2, GIG2, SKIP1, TRB-1, TRB1
• Gene name: tribbles pseudokinase 1
• Alternate names: tribbles homolog 1, G-protein-coupled receptor induced protein, G-protein-coupled receptor-induced gene 2 protein, G-protein-coupled receptor-induced protein 2, phosphoprotein regulated by mitogenic pathways, tribbles-like protein 1,
• Gene location: 8q24.13 (125430289: 125438404)     Exons: 4     NC_000008.11
• OMIM: 609461

Protein Summary

• Protein general information: Q96RU8  
  • Name: Tribbles homolog 1 (TRB 1) (G protein coupled receptor induced gene 2 protein) (GIG 2) (SKIP1)
  • Length: 372  
  • Mass: 41009
  • Tissue specificity: Expressed in most human tissues with the highest levels in skeletal muscle, thyroid gland, pancreas, peripheral blood leukocytes, and bone marrow. {ECO
• Sequence:

  MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPPGSPCSPQPPPAA
  PGAGGGSGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSNITGIVEVI
  LGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRKFVFSTEERTQLRLES
  LEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQ
  FCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSEIGTSDQIVPEYQEDSDISSFFC

• Structural information:
  • Protein Domains: (1..33-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR024105  IPR024104  
  • Prosite: PS50011
  • PDB: 5CEK 5CEM 5IGO 5IGQ 6DC0
  • PDBsum: 5CEK 5CEM 5IGO 5IGQ 6DC0
  • DIP: 34542
  • STRING: ENSP00000312150
• Other Databases: GeneCards:  TRIB1  Malacards:  TRIB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0031434	mitogen-activated protein kinase kinase binding	IBA	molecular function
GO:0043405	regulation of MAP kinase activity	IBA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0004860	protein kinase inhibitor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045651	positive regulation of macrophage differentiation	IEA	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0055106	ubiquitin-protein transferase regulator activity	IEA	molecular function
GO:0045659	negative regulation of neutrophil differentiation	IEA	biological process
GO:0045645	positive regulation of eosinophil differentiation	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0031434	mitogen-activated protein kinase kinase binding	IDA	molecular function
GO:0031434	mitogen-activated protein kinase kinase binding	IDA	molecular function
GO:0031625	ubiquitin protein ligase binding	ISS	molecular function
GO:0004672	protein kinase activity	TAS	NOT|molecular function
GO:0004860	protein kinase inhibitor activity	IMP	molecular function
GO:0005524	ATP binding	TAS	NOT|molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0055106	ubiquitin-protein transferase regulator activity	ISS	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0007254	JNK cascade	IMP	biological process
GO:0014912	negative regulation of smooth muscle cell migration	IMP	biological process
GO:0031665	negative regulation of lipopolysaccharide-mediated signaling pathway	IMP	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	ISS	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0006468	protein phosphorylation	TAS	NOT|biological process
GO:0006469	negative regulation of protein kinase activity	IMP	biological process
GO:0032496	response to lipopolysaccharide	ISS	biological process
GO:0032496	response to lipopolysaccharide	IMP	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IMP	biological process
GO:0043405	regulation of MAP kinase activity	IDA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq