• Gene id: 10219

Gene Summary

• Gene Symbol: KLRG1   Gene   UCSC   Ensembl
• Aliases: 2F1, CLEC15A, MAFA, MAFA-2F1, MAFA-L, MAFA-LIKE
• Gene name: killer cell lectin like receptor G1
• Alternate names: killer cell lectin-like receptor subfamily G member 1, C-type lectin domain family 15 member A, ITIM-containing receptor MAFA-L, MAFA-like receptor, killer cell lectin-like receptor subfamily G, member 1, mast cell function-associated antigen (ITIM-containing),
• Gene location: 12p13.31 (8950043: 9215656)     Exons: 12     NC_000012.12
• Gene summary(Entrez): Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to t
• OMIM: 606726

Protein Summary

• Protein general information: Q96E93  
  • Name: Killer cell lectin like receptor subfamily G member 1 (C type lectin domain family 15 member A) (ITIM containing receptor MAFA L) (MAFA like receptor) (Mast cell function associated antigen)
  • Length: 195  
  • Mass: 21831
  • Tissue specificity: Expressed specifically on natural killer (NK) cells and T-cells, mainly CD8 T-cells. {ECO
• Sequence:

  MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSC
  PDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLN
  FSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

• Structural information:
  • Protein Domains: (82..18-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR016187  IPR042190  IPR033992  
  • Prosite: PS50041
  • CDD: cd03593
  • PDB: 3FF7
  • PDBsum: 3FF7
  • STRING: ENSP00000349477
• Other Databases: GeneCards:  KLRG1  Malacards:  KLRG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030246	carbohydrate binding	TAS	molecular function
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0006954	inflammatory response	TAS	biological process
GO:0006968	cellular defense response	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881