• Gene id: 102157402

Gene Summary

• Gene Symbol: AK6   Gene   UCSC   Ensembl
• Aliases: AD-004, CGI-137, CINAP, CIP, hCINAP
• Gene name: adenylate kinase 6
• Alternate names: adenylate kinase isoenzyme 6, ATP-AMP transphosphorylase 6, adrenal gland protein AD-004, coilin interacting nuclear ATPase protein, coilin interacting protein,
• Gene location: 5q13.2 (69369823: 69350983)     Exons: 6     NC_000005.10
• Gene summary(Entrez): This gene encodes a protein that belongs to the adenylate kinase family of enzymes. The protein has a nuclear localization and contains Walker A (P-loop) and Walker B motifs and a metal-coordinating residue. The protein may be involved in regulation of Ca

Protein Summary

• Protein general information: Q9Y3D8  
  • Name: Adenylate kinase isoenzyme 6 (AK6) (EC 2.7.4.3) (Adrenal gland protein AD 004) (Coilin interacting nuclear ATPase protein) (hCINAP) (Dual activity adenylate kinase/ATPase) (AK/ATPase)
  • Length: 172  
  • Mass: 20061
  • Tissue specificity: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, chorionic villi and the central nervous system. {ECO
• Sequence:

  MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVI
  VDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPE
  ELENNVDQILKWIEQWIKDHNS

• Structural information:
  • Interpro: IPR020618  IPR027417  
  • PDB: 1RKB 3IIJ 3IIK 3IIL 3IIM 5JZV
  • PDBsum: 1RKB 3IIJ 3IIK 3IIL 3IIM 5JZV
  • STRING: ENSP00000370201
• Other Databases: GeneCards:  AK6  Malacards:  AK6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005524	ATP binding	IBA	molecular function
GO:0004017	adenylate kinase activity	IBA	molecular function
GO:0004017	adenylate kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004017	adenylate kinase activity	IEA	molecular function
GO:0050145	nucleoside monophosphate kinase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0015949	nucleobase-containing small molecule interconversion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015030	Cajal body	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016887	ATPase activity	IEA	molecular function
GO:0004017	adenylate kinase activity	IEA	molecular function
GO:0015030	Cajal body	IEA	cellular component
GO:0046940	nucleoside monophosphate phosphorylation	IEA	biological process
GO:0046940	nucleoside monophosphate phosphorylation	IEA	biological process
GO:0046940	nucleoside monophosphate phosphorylation	IEA	biological process
GO:0046940	nucleoside monophosphate phosphorylation	IEA	biological process
GO:0046940	nucleoside monophosphate phosphorylation	IEA	biological process
GO:0046940	nucleoside monophosphate phosphorylation	IEA	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0015030	Cajal body	IDA	cellular component
GO:0005730	nucleolus	IDA	NOT|cellular component
GO:0004017	adenylate kinase activity	IDA	molecular function
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)