• Gene id: 10214

Gene Summary

• Gene Symbol: SSX3   Gene   UCSC   Ensembl
• Aliases: CT5.3
• Gene name: SSX family member 3
• Alternate names: protein SSX3, Kruppel-associated box containing gene product SSX3, cancer/testis antigen 5.3, synovial sarcoma, X breakpoint 3,
• Gene location: Xp11.23 (48356705: 48346426)     Exons: 9     NC_000023.11
• Gene summary(Entrez): The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune respons
• OMIM: 102593

Protein Summary

• Protein general information: Q99909  
  • Name: Protein SSX3 (Cancer/testis antigen 5.3) (CT5.3)
  • Length: 188  
  • Mass: 21697
• Sequence:

  MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSFMRNKR
  VTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLCPPGKPTTSEK
  INMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE

• Structural information:
  • Protein Domains: (20..8-)
    (/note="KRAB-related-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00120"-)
  • Interpro: IPR001909  IPR036051  IPR003655  IPR028804  IPR019041  
  • Prosite: PS50806
  • CDD: cd07765
  • STRING: ENSP00000298396
• Other Databases: GeneCards:  SSX3  Malacards:  SSX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881