• Gene id: 10211

Gene Summary

• Gene Symbol: FLOT1   Gene   UCSC   Ensembl
• Gene name: flotillin 1
• Alternate names: flotillin-1, integral membrane component of caveolae,
• Gene location: 6p21.33 (30742850: 30727708)     Exons: 19     NC_000006.12
• Gene summary(Entrez): This gene encodes an protein that localizes to the caveolae, which are small domains on the inner cell membranes. This protein plays a role in vesicle trafficking and cell morphology. Alternative splicing results in multiple transcript variants. [provided
• OMIM: 606998

Protein Summary

• Protein general information: O75955  
  • Name: Flotillin 1
  • Length: 427  
  • Mass: 47355
• Sequence:

  MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQG
  QNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYT
  LKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDI
  EVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEA
  EKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSA
  NKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVNHKPLRTA

• Structural information:
  • Interpro: IPR001107  IPR036013  IPR031905  IPR027705  
  • STRING: ENSP00000365569
• Other Databases: GeneCards:  FLOT1  Malacards:  FLOT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0008180	COP9 signalosome	IDA	colocalizes with
GO:0005886	plasma membrane	TAS	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005901	caveola	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1901741	positive regulation of myoblast fusion	IEA	biological process
GO:0044853	plasma membrane raft	IEA	cellular component
GO:0042383	sarcolemma	IEA	cellular component
GO:0035023	regulation of Rho protein signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0007409	axonogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0002090	regulation of receptor internalization	IEA	biological process
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0048786	presynaptic active zone	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0002020	protease binding	IEA	molecular function
GO:2000049	positive regulation of cell-cell adhesion mediated by cadherin	IEA	biological process
GO:1901890	positive regulation of cell junction assembly	IEA	biological process
GO:0072659	protein localization to plasma membrane	IEA	biological process
GO:0070528	protein kinase C signaling	IEA	biological process
GO:0048643	positive regulation of skeletal muscle tissue development	IEA	biological process
GO:0045807	positive regulation of endocytosis	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0032226	positive regulation of synaptic transmission, dopaminergic	IEA	biological process
GO:0032092	positive regulation of protein binding	IEA	biological process
GO:0016600	flotillin complex	IEA	cellular component
GO:0005901	caveola	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0035255	ionotropic glutamate receptor binding	IEA	molecular function
GO:0016600	flotillin complex	IEA	cellular component
GO:0005901	caveola	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0045121	membrane raft	IDA	cellular component
GO:0005815	microtubule organizing center	IDA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0005901	caveola	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016600	flotillin complex	IDA	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0016600	flotillin complex	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	NOT|cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0001931	uropod	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0044291	cell-cell contact zone	IDA	cellular component
GO:0005912	adherens junction	IDA	cellular component
GO:0016600	flotillin complex	IDA	cellular component
GO:0016600	flotillin complex	IDA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0030864	cortical actin cytoskeleton	IDA	colocalizes with
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0044854	plasma membrane raft assembly	IMP	biological process
GO:0070528	protein kinase C signaling	IMP	biological process
GO:2000049	positive regulation of cell-cell adhesion mediated by cadherin	IMP	biological process
GO:0005765	lysosomal membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0002090	regulation of receptor internalization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1901741	positive regulation of myoblast fusion	IMP	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0022617	extracellular matrix disassembly	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0032226	positive regulation of synaptic transmission, dopaminergic	ISS	biological process
GO:0045807	positive regulation of endocytosis	IMP	biological process
GO:1901890	positive regulation of cell junction assembly	IMP	biological process
GO:0032092	positive regulation of protein binding	IMP	biological process
GO:0048643	positive regulation of skeletal muscle tissue development	IMP	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:1903044	protein localization to membrane raft	IMP	biological process
GO:0033227	dsRNA transport	IMP	biological process
GO:0001819	positive regulation of cytokine production	IMP	biological process
GO:0001765	membrane raft assembly	IMP	biological process
GO:0071360	cellular response to exogenous dsRNA	IMP	biological process
GO:0032728	positive regulation of interferon-beta production	IMP	biological process
GO:0060355	positive regulation of cell adhesion molecule production	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0034141	positive regulation of toll-like receptor 3 signaling pathway	IMP	biological process
GO:0034143	regulation of toll-like receptor 4 signaling pathway	IMP	NOT|biological process
GO:0005886	plasma membrane	IMP	cellular component
GO:0034976	response to endoplasmic reticulum stress	IMP	biological process
GO:0034116	positive regulation of heterotypic cell-cell adhesion	IMP	biological process
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0051580	regulation of neurotransmitter uptake	IMP	biological process
GO:0051580	regulation of neurotransmitter uptake	IMP	biological process
GO:0051580	regulation of neurotransmitter uptake	IDA	biological process
GO:0098691	dopaminergic synapse	IMP	cellular component
GO:0098691	dopaminergic synapse	IMP	cellular component
GO:0098691	dopaminergic synapse	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04910	Insulin signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray