• Gene id: 1021

Gene Summary

• Gene Symbol: CDK6   Gene   UCSC   Ensembl
• Aliases: MCPH12, PLSTIRE
• Gene name: cyclin dependent kinase 6
• Alternate names: cyclin-dependent kinase 6, cell division protein kinase 6, serine/threonine-protein kinase PLSTIRE,
• Gene location: 7q21.2 (92836572: 92604920)     Exons: 5     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is a member of the CMGC family of serine/threonine protein kinases. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity o
• OMIM: 603368

Protein Summary

• Protein general information: Q00534  
  • Name: Cyclin dependent kinase 6 (EC 2.7.11.22) (Cell division protein kinase 6) (Serine/threonine protein kinase PLSTIRE)
  • Length: 326  
  • Mass: 36938
  • Tissue specificity: Expressed ubiquitously. Accumulates in squamous cell carcinomas, proliferating hematopoietic progenitor cells, beta-cells of pancreatic islets of Langerhans, and neuroblastomas. Reduced levels in differentiating cells. {ECO
• Sequence:

  MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPN
  VVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQN
  ILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDV
  DQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
  QDLERCKENLDSHLPPSQNTSELNTA

• Structural information:
  • Protein Domains: (13..30-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR028788  IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • CDD: cd07862
  • PDB: 1BI7 1BI8 1BLX 1G3N 1JOW 1XO2 2EUF 2F2C 3NUP 3NUX 4AUA 4EZ5 4TTH 5L2I 5L2S 5L2T
  • PDBsum: 1BI7 1BI8 1BLX 1G3N 1JOW 1XO2 2EUF 2F2C 3NUP 3NUX 4AUA 4EZ5 4TTH 5L2I 5L2S 5L2T
  • DIP: 687
  • STRING: ENSP00000265734
• Other Databases: GeneCards:  CDK6  Malacards:  CDK6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098770	FBXO family protein binding	IPI	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0051726	regulation of cell cycle	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0006468	protein phosphorylation	IBA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:2000773	negative regulation of cellular senescence	IDA	biological process
GO:0045638	negative regulation of myeloid cell differentiation	IDA	biological process
GO:0003323	type B pancreatic cell development	IDA	biological process
GO:0045656	negative regulation of monocyte differentiation	IDA	biological process
GO:2000145	regulation of cell motility	ISS	biological process
GO:0048699	generation of neurons	ISS	biological process
GO:0045596	negative regulation of cell differentiation	TAS	biological process
GO:0021542	dentate gyrus development	ISS	biological process
GO:0014002	astrocyte development	ISS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0021670	lateral ventricle development	ISS	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0043697	cell dedifferentiation	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902036	regulation of hematopoietic stem cell differentiation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0097132	cyclin D2-CDK6 complex	IEA	cellular component
GO:0060218	hematopoietic stem cell differentiation	IEA	biological process
GO:0033077	T cell differentiation in thymus	IEA	biological process
GO:0030097	hemopoiesis	IEA	biological process
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0030332	cyclin binding	IEA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IDA	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030332	cyclin binding	IPI	molecular function
GO:0030332	cyclin binding	IPI	molecular function
GO:0030332	cyclin binding	IPI	molecular function
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IDA	cellular component
GO:0001726	ruffle	IDA	cellular component
GO:0001954	positive regulation of cell-matrix adhesion	IDA	biological process
GO:0050680	negative regulation of epithelial cell proliferation	IMP	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0010468	regulation of gene expression	IDA	biological process
GO:0045668	negative regulation of osteoblast differentiation	IDA	biological process
GO:0010468	regulation of gene expression	IMP	biological process
GO:0042063	gliogenesis	IMP	biological process
GO:0043697	cell dedifferentiation	IMP	biological process
GO:0045646	regulation of erythrocyte differentiation	IMP	biological process
GO:0048146	positive regulation of fibroblast proliferation	IMP	biological process
GO:0001726	ruffle	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0045786	negative regulation of cell cycle	IDA	biological process
GO:0009615	response to virus	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa05206	MicroRNAs in cancer
hsa05163	Human cytomegalovirus infection
hsa05203	Viral carcinogenesis
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05164	Influenza A
hsa04218	Cellular senescence
hsa05224	Breast cancer
hsa05160	Hepatitis C
hsa04110	Cell cycle
hsa05162	Measles
hsa05222	Small cell lung cancer
hsa05220	Chronic myeloid leukemia
hsa05214	Glioma
hsa05212	Pancreatic cancer
hsa05218	Melanoma
hsa04115	p53 signaling pathway
hsa05223	Non-small cell lung cancer

Diseases

Associated diseases	References
Primary microcephaly	KEGG:H00269
Primary microcephaly	KEGG:H00269
medulloblastoma	PMID:16314645
Glioblastoma multiforme	PMID:10884881
Malignant glioma	PMID:22736304
Malignant glioma	PMID:9102208
pancreatic ductal carcinoma	PMID:24389175
lung non-small cell carcinoma	PMID:27874949
lung non-small cell carcinoma	PMID:23591808
lung adenocarcinoma	PMID:10574260
pancreatic adenocarcinoma	PMID:25050737
Non-functioning pancreatic endocrine tumor	PMID:29149451
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R