About Us

Search Result


Gene id 10209
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol EIF1   Gene   UCSC   Ensembl
Aliases A121, EIF-1, EIF1A, ISO1, SUI1
Gene name eukaryotic translation initiation factor 1
Alternate names eukaryotic translation initiation factor 1, protein translation factor SUI1 homolog, sui1iso1,
Gene location 17q21.2 (41688884: 41692667)     Exons: 4     NC_000017.11

Protein Summary

Protein general information P41567  

Name: Eukaryotic translation initiation factor 1 (eIF1) (A121) (Protein translation factor SUI1 homolog) (Sui1iso1)

Length: 113  Mass: 12732

Sequence MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIE
HPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF
Structural information
Interpro:  IPR001950  IPR036877  IPR005874  
Prosite:   PS50296
CDD:   cd11566

PDB:  
2IF1 4KZX 4KZY
PDBsum:   2IF1 4KZX 4KZY

DIP:  

50783

MINT:  
STRING:   ENSP00000419449
Other Databases GeneCards:  EIF1  Malacards:  EIF1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0006446 regulation of translation
al initiation
IDA biological process
GO:0003743 translation initiation fa
ctor activity
IBA molecular function
GO:0016282 eukaryotic 43S preinitiat
ion complex
IBA cellular component
GO:0003723 RNA binding
IBA molecular function
GO:0043024 ribosomal small subunit b
inding
IBA molecular function
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0006413 translational initiation
IEA biological process
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0006412 translation
IEA biological process
GO:0006413 translational initiation
IEA biological process
GO:0003743 translation initiation fa
ctor activity
TAS molecular function
GO:0008135 translation factor activi
ty, RNA binding
TAS molecular function
GO:0005737 cytoplasm
TAS cellular component
GO:0006446 regulation of translation
al initiation
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0009048 dosage compensation by in
activation of X chromosom
e
IEA biological process
GO:0005737 cytoplasm
IDA cellular component
GO:0005634 nucleus
IDA cellular component
GO:0003723 RNA binding
HDA molecular function
GO:0003743 translation initiation fa
ctor activity
NAS molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa03013RNA transport
Associated diseases References
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract