• Gene id: 10206

Gene Summary

• Gene Symbol: TRIM13   Gene   UCSC   Ensembl
• Aliases: CAR, DLEU5, LEU5, RFP2, RNF77
• Gene name: tripartite motif containing 13
• Alternate names: E3 ubiquitin-protein ligase TRIM13, B-cell chronic lymphocytic leukemia tumor suppressor Leu5, CLL-associated RING finger, RING finger protein 77, RING-type E3 ubiquitin transferase TRIM13, leukemia-associated protein 5, putative tumor suppressor RFP2, ret finge,
• Gene location: 13q14.2 (49997041: 50018466)     Exons: 4     NC_000013.11
• Gene summary(Entrez): This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This gene is located on chromosome 13 within the minimal deletion re
• OMIM: 605661

Protein Summary

• Protein general information: O60858  
  • Name: E3 ubiquitin protein ligase TRIM13 (EC 2.3.2.27) (B cell chronic lymphocytic leukemia tumor suppressor Leu5) (Leukemia associated protein 5) (Putative tumor suppressor RFP2) (RING finger protein 77) (RING type E3 ubiquitin transferase TRIM13) (Ret finger
  • Length: 407  
  • Mass: 46988
• Sequence:

  MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQVNYSL
  KGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDMQLICGICATRGEHTKHVFCSIEDAYAQERDAFESLFQSFE
  TWRRGDALSRLDTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTI
  LQEQRMAFNIAEAFKDVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKNFDTSQWEDIKLVDVDKLSLP
  QDTGTFISKIPWSFYKLFLLILLLGLVIVFGPTMFLEWSLFDDLATWKGCLSNFSSYLTKTADFIEQSVFYWEQV
  TDGFFIFNERFKNFTLVVLNNVAEFVCKYKLL

• Structural information:
  • Interpro: IPR027370  IPR000315  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50119 PS00518 PS50089
  • CDD: cd00021
  • STRING: ENSP00000348299
• Other Databases: GeneCards:  TRIM13  Malacards:  TRIM13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016239	positive regulation of macroautophagy	IBA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0016567	protein ubiquitination	IBA	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IBA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0097038	perinuclear endoplasmic reticulum	IDA	cellular component
GO:0097038	perinuclear endoplasmic reticulum	IDA	cellular component
GO:0016239	positive regulation of macroautophagy	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IDA	biological process
GO:0010942	positive regulation of cell death	IDA	biological process
GO:0010332	response to gamma radiation	IEP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0061630	ubiquitin protein ligase activity	TAS	molecular function
GO:1904380	endoplasmic reticulum mannose trimming	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0044322	endoplasmic reticulum quality control compartment	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:1902187	negative regulation of viral release from host cell	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0032897	negative regulation of viral transcription	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881