• Gene id: 10204

Gene Summary

• Gene Symbol: NUTF2   Gene   UCSC   Ensembl
• Aliases: NTF-2, NTF2, PP15
• Gene name: nuclear transport factor 2
• Alternate names: nuclear transport factor 2, placental protein 15,
• Gene location: 16q22.1 (67846932: 67872566)     Exons: 7     NC_000016.10
• Gene summary(Entrez): This gene encodes a cytosolic factor that facilitates protein transport into the nucleus. The encoded protein is required for nuclear import of the small Ras-like GTPase, Ran which is involved in numerous cellular processes. This protein also interacts wi
• OMIM: 604049

Protein Summary

• Protein general information: P61970  
  • Name: Nuclear transport factor 2 (NTF 2) (Placental protein 15) (PP15)
  • Length: 127  
  • Mass: 14478
• Sequence:

  MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQP
  TPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG

• Structural information:
  • Protein Domains: (10..12-)
    (/note="NTF2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00137"-)
  • Interpro: IPR002075  IPR032710  IPR018222  
  • Prosite: PS50177
  • CDD: cd00780
  • PDB: 1GY5
  • PDBsum: 1GY5
  • DIP: 6057
  • STRING: ENSP00000219169
• Other Databases: GeneCards:  NUTF2  Malacards:  NUTF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0044613	nuclear pore central transport channel	IBA	cellular component
GO:0006913	nucleocytoplasmic transport	IBA	biological process
GO:0006606	protein import into nucleus	IBA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0008536	Ran GTPase binding	IDA	molecular function
GO:0006606	protein import into nucleus	IDA	biological process
GO:0006606	protein import into nucleus	IDA	biological process
GO:0031965	nuclear membrane	ISS	cellular component
GO:0090204	protein localization to nuclear pore	ISS	biological process
GO:0005643	nuclear pore	IEA	cellular component
GO:0051028	mRNA transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090204	protein localization to nuclear pore	IEA	biological process
GO:0031965	nuclear membrane	IEA	cellular component
GO:0008536	Ran GTPase binding	IEA	molecular function
GO:0006606	protein import into nucleus	IEA	biological process
GO:0005640	nuclear outer membrane	IEA	cellular component
GO:1904046	negative regulation of vascular endothelial growth factor production	IEA	biological process
GO:0061608	nuclear import signal receptor activity	IEA	molecular function
GO:0044613	nuclear pore central transport channel	IEA	cellular component
GO:0042307	positive regulation of protein import into nucleus	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0006611	protein export from nucleus	IDA	biological process
GO:0005640	nuclear outer membrane	IEA	cellular component
GO:0005643	nuclear pore	IEA	cellular component
GO:0005637	nuclear inner membrane	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0017056	structural constituent of nuclear pore	IDA	molecular function
GO:0017056	structural constituent of nuclear pore	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008536	Ran GTPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Diabetic retinopathy	PMID:19404486
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881