• Gene id: 10203

Gene Summary

• Gene Symbol: CALCRL   Gene   UCSC   Ensembl
• Aliases: CGRPR, CRLR, LMPHM8
• Gene name: calcitonin receptor like receptor
• Alternate names: calcitonin gene-related peptide type 1 receptor, CGRP type 1 receptor, calcitonin receptor-like,
• Gene location: 2q32.1 (187448303: 187341963)     Exons: 17     NC_000002.12
• OMIM: 114190

Protein Summary

• Protein general information: Q16602  
  • Name: Calcitonin gene related peptide type 1 receptor (CGRP type 1 receptor) (Calcitonin receptor like receptor)
  • Length: 461  
  • Mass: 52929
  • Tissue specificity: Predominantly expressed in the lung and heart.
• Sequence:

  MEKKCTLNFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCW
  NDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHG
  LSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGC
  NYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICA
  ALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKIAEEVYDYIMHILMHF
  QGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIE
  NVLLKPENLYN

• Structural information:
  • Interpro: IPR003287  IPR017981  IPR003289  IPR036445  IPR001879   IPR000832  IPR017983  
  • Prosite: PS00649 PS00650 PS50227 PS50261
  • PDB: 3AQF 3N7P 3N7R 3N7S 4RWF 4RWG 5V6Y 6D1U 6E3Y
  • PDBsum: 3AQF 3N7P 3N7R 3N7S 4RWF 4RWG 5V6Y 6D1U 6E3Y
  • DIP: 37674
  • STRING: ENSP00000386972
• Other Databases: GeneCards:  CALCRL  Malacards:  CALCRL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0001635	calcitonin gene-related peptide receptor activity	IBA	molecular function
GO:0001605	adrenomedullin receptor activity	IBA	molecular function
GO:0001525	angiogenesis	IBA	biological process
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0001605	adrenomedullin receptor activity	IPI	molecular function
GO:0004948	calcitonin receptor activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0001635	calcitonin gene-related peptide receptor activity	IEA	molecular function
GO:0045986	negative regulation of smooth muscle contraction	IEA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006816	calcium ion transport	IDA	biological process
GO:0005768	endosome	IDA	cellular component
GO:1990406	CGRP receptor complex	IDA	cellular component
GO:0071329	cellular response to sucrose stimulus	IDA	biological process
GO:0015031	protein transport	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0001525	angiogenesis	IDA	biological process
GO:1990406	CGRP receptor complex	IDA	cellular component
GO:0031623	receptor internalization	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	colocalizes with
GO:1903143	adrenomedullin receptor complex	IDA	cellular component
GO:1903143	adrenomedullin receptor complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:1903143	adrenomedullin receptor complex	IDA	cellular component
GO:1903143	adrenomedullin receptor complex	IDA	cellular component
GO:0031623	receptor internalization	IDA	biological process
GO:0001635	calcitonin gene-related peptide receptor activity	IPI	molecular function
GO:0001605	adrenomedullin receptor activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990410	adrenomedullin receptor signaling pathway	IPI	biological process
GO:1990410	adrenomedullin receptor signaling pathway	IPI	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1990408	calcitonin gene-related peptide receptor signaling pathway	IPI	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	biological process
GO:0001605	adrenomedullin receptor activity	IPI	molecular function
GO:1990410	adrenomedullin receptor signaling pathway	IPI	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	biological process
GO:1990409	adrenomedullin binding	IPI	molecular function
GO:0001605	adrenomedullin receptor activity	IPI	molecular function
GO:0001635	calcitonin gene-related peptide receptor activity	IPI	molecular function
GO:1990409	adrenomedullin binding	IPI	molecular function
GO:1990410	adrenomedullin receptor signaling pathway	IPI	biological process
GO:1990408	calcitonin gene-related peptide receptor signaling pathway	IPI	biological process
GO:1990410	adrenomedullin receptor signaling pathway	IPI	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04270	Vascular smooth muscle contraction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R