• Gene id: 10202

Gene Summary

• Gene Symbol: DHRS2   Gene   UCSC   Ensembl
• Aliases: HEP27, SDR25C1
• Gene name: dehydrogenase/reductase 2
• Alternate names: dehydrogenase/reductase SDR family member 2, mitochondrial, dehydrogenase/reductase (SDR family) member 2, dehydrogenase/reductase member 2, dicarbonyl reductase HEP27, protein D, short chain dehydrogenase/reductase family 25C member 1, short-chain alcohol dehy,
• Gene location: 14q11.2 (23630114: 23645638)     Exons: 13     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family, which has over 46,000 members. Members of this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids a
• OMIM: 615194

Protein Summary

• Protein general information: Q13268  
  • Name: Dehydrogenase/reductase SDR family member 2, mitochondrial (EC 1.1.1. ) (Dicarbonyl reductase HEP27) (Protein D) (Short chain dehydrogenase/reductase family 25C member 1)
  • Length: 280  
  • Mass: 29927
  • Tissue specificity: Widely expressed, with highest levels in liver and kidney, followed by heart, spleen, skeletal muscle and placenta. In hemopoietic cells, expressed in dendritic cells, but not in monocytes, macrophages, granulocytes, nor in B and T lym
• Sequence:

  MLSAVARGYQGWFHPCARLSVRMSSTGIDRKGVLANRVAVVTGSTSGIGFAIARRLARDGAHVVISSRKQQNVDR
  AMAKLQGEGLSVAGIVCHVGKAEDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPA
  LLLSQLLPYMENRRGAVILVSSIAAYNPVVALGVYNVSKTALLGLTRTLALELAPKDIRVNCVVPGIIKTDFSKV
  FHGNESLWKNFKEHHQLQRIGESEDCAGIVSFLCSPDASYVNGENIAVAGYSTRL

• Structural information:
  • Interpro: IPR027052  IPR036291  IPR020904  IPR002347  
  • Prosite: PS00061
  • STRING: ENSP00000344674
• Other Databases: GeneCards:  DHRS2  Malacards:  DHRS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0009636	response to toxic substance	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0004090	carbonyl reductase (NADPH) activity	IDA	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0008285	negative regulation of cell population proliferation	NAS	biological process
GO:0043011	myeloid dendritic cell differentiation	IEP	biological process
GO:0008207	C21-steroid hormone metabolic process	NAS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)