• Gene id: 10201

Gene Summary

• Gene Symbol: NME6   Gene   UCSC   Ensembl
• Aliases: IPIA-ALPHA, NDK 6, NM23-H6
• Gene name: NME/NM23 nucleoside diphosphate kinase 6
• Alternate names: nucleoside diphosphate kinase 6, NDP kinase 6, inhibitor of p53-induced apoptosis-alpha, non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase),
• Gene location: 3p21.31 (48302903: 48288401)     Exons: 8     NC_000003.12
• Gene summary(Entrez): Nucleoside diphosphate (NDP) kinases (EC 2.7.4.6), such as NME6, are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates (Mehus et al., 1999 [PubM
• OMIM: 608294

Protein Summary

• Protein general information: O75414  
  • Name: Nucleoside diphosphate kinase 6 (NDK 6) (NDP kinase 6) (EC 2.7.4.6) (Inhibitor of p53 induced apoptosis alpha) (IPIA alpha) (nm23 H6)
  • Length: 186  
  • Mass: 21142
  • Tissue specificity: Expressed at a moderately low level in many tissues. Most abundant in kidney, prostate, ovary, intestine, and spleen.
• Sequence:

  MASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEF
  MASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSE
  QRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA

• Structural information:
  • Interpro: IPR034907  IPR036850  IPR037994  IPR001564  IPR023005  
  • Prosite: PS00469
  • CDD: cd04414
  • STRING: ENSP00000416658
• Other Databases: GeneCards:  NME6  Malacards:  NME6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004550	nucleoside diphosphate kinase activity	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0045839	negative regulation of mitotic nuclear division	IBA	biological process
GO:0030308	negative regulation of cell growth	IBA	biological process
GO:0006228	UTP biosynthetic process	IEA	biological process
GO:0006241	CTP biosynthetic process	IEA	biological process
GO:0004550	nucleoside diphosphate kinase activity	IEA	molecular function
GO:0006165	nucleoside diphosphate phosphorylation	IEA	biological process
GO:0006183	GTP biosynthetic process	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0009117	nucleotide metabolic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0004550	nucleoside diphosphate kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0045839	negative regulation of mitotic nuclear division	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0004550	nucleoside diphosphate kinase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism
hsa00983	Drug metabolism - other enzymes
hsa00240	Pyrimidine metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)