• Gene id: 10200

Gene Summary

• Gene Symbol: MPHOSPH6   Gene   UCSC   Ensembl
• Aliases: MPP, MPP-6, MPP6
• Gene name: M-phase phosphoprotein 6
• Alternate names: M-phase phosphoprotein 6,
• Gene location: 16q23.3 (82170223: 82148161)     Exons: 6     NC_000016.10
• OMIM: 605500

Protein Summary

• Protein general information: Q99547  
  • Name: M phase phosphoprotein 6
  • Length: 160  
  • Mass: 19024
• Sequence:

  MAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDLLYGRM
  SFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEEDENGDITPIK
  AKKMFLKPQD

• Structural information:
  • Interpro: IPR019324  
  • PDB: 6D6Q 6D6R 6H25
  • PDBsum: 6D6Q 6D6R 6H25
  • DIP: 31131
  • STRING: ENSP00000258169
• Other Databases: GeneCards:  MPHOSPH6  Malacards:  MPHOSPH6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000460	maturation of 5.8S rRNA	IBA	biological process
GO:0000176	nuclear exosome (RNase complex)	IDA	colocalizes with
GO:0000178	exosome (RNase complex)	IDA	colocalizes with
GO:0000460	maturation of 5.8S rRNA	IMP	biological process
GO:0000176	nuclear exosome (RNase complex)	TAS	colocalizes with
GO:0006364	rRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006364	rRNA processing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000178	exosome (RNase complex)	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)