• Gene id: 1020

Gene Summary

• Gene Symbol: CDK5   Gene   UCSC   Ensembl
• Aliases: LIS7, PSSALRE
• Gene name: cyclin dependent kinase 5
• Alternate names: cyclin-dependent-like kinase 5, TPKII catalytic subunit, cell division protein kinase 5, epididymis secretory sperm binding protein, protein kinase CDK5 splicing, serine/threonine-protein kinase PSSALRE, tau protein kinase II catalytic subunit,
• Gene location: 7q36.1 (151057896: 151053814)     Exons: 12     NC_000007.14
• Gene summary(Entrez): This gene encodes a proline-directed serine/threonine kinase that is a member of the cyclin-dependent kinase family of proteins. Unlike other members of the family, the protein encoded by this gene does not directly control cell cycle regulation. Instead
• OMIM: 600759

Protein Summary

• Protein general information: Q00535  
  • Name: Cyclin dependent like kinase 5 (EC 2.7.11.1) (Cell division protein kinase 5) (Serine/threonine protein kinase PSSALRE) (Tau protein kinase II catalytic subunit) (TPKII catalytic subunit)
  • Length: 292  
  • Mass: 33304
  • Tissue specificity: Isoform 1 is ubiquitously expressed. Accumulates in cortical neurons (at protein level). Isoform 2 has only been detected in testis, skeletal muscle, colon, bone marrow and ovary. {ECO
• Sequence:

  MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKK
  LTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARA
  FGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEE
  QWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

• Structural information:
  • Protein Domains: (4..28-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 1H4L 1LFR 1UNG 1UNH 1UNL 3O0G 4AU8
  • PDBsum: 1H4L 1LFR 1UNG 1UNH 1UNL 3O0G 4AU8
  • DIP: 24221
  • STRING: ENSP00000419782
• Other Databases: GeneCards:  CDK5  Malacards:  CDK5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008017	microtubule binding	TAS	NOT|molecular function
GO:0004674	protein serine/threonine kinase activity	NAS	molecular function
GO:0048156	tau protein binding	NAS	molecular function
GO:0050321	tau-protein kinase activity	NAS	molecular function
GO:1904646	cellular response to amyloid-beta	ISS	biological process
GO:0006468	protein phosphorylation	TAS	biological process
GO:1903076	regulation of protein localization to plasma membrane	ISS	biological process
GO:0043005	neuron projection	ISS	cellular component
GO:0018105	peptidyl-serine phosphorylation	ISS	biological process
GO:0048167	regulation of synaptic plasticity	TAS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005874	microtubule	ISS	colocalizes with
GO:0030426	growth cone	ISS	cellular component
GO:0016020	membrane	ISS	cellular component
GO:0031175	neuron projection development	TAS	biological process
GO:0000226	microtubule cytoskeleton organization	TAS	biological process
GO:0018107	peptidyl-threonine phosphorylation	ISS	biological process
GO:0051966	regulation of synaptic transmission, glutamatergic	ISS	biological process
GO:1901215	negative regulation of neuron death	IDA	biological process
GO:1903421	regulation of synaptic vesicle recycling	NAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0045861	negative regulation of proteolysis	IMP	biological process
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006468	protein phosphorylation	IBA	biological process
GO:0007409	axonogenesis	IBA	biological process
GO:0048489	synaptic vesicle transport	IBA	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0051402	neuron apoptotic process	IBA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0016310	phosphorylation	IDA	biological process
GO:0048709	oligodendrocyte differentiation	IDA	biological process
GO:0051402	neuron apoptotic process	TAS	biological process
GO:0048675	axon extension	TAS	biological process
GO:0048167	regulation of synaptic plasticity	TAS	biological process
GO:0048167	regulation of synaptic plasticity	ISS	biological process
GO:0016079	synaptic vesicle exocytosis	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0001764	neuron migration	TAS	biological process
GO:2000251	positive regulation of actin cytoskeleton reorganization	TAS	biological process
GO:0071156	regulation of cell cycle arrest	TAS	biological process
GO:0061001	regulation of dendritic spine morphogenesis	ISS	biological process
GO:0048488	synaptic vesicle endocytosis	TAS	biological process
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0030182	neuron differentiation	TAS	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:0007416	synapse assembly	TAS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1904646	cellular response to amyloid-beta	IEA	biological process
GO:1901387	positive regulation of voltage-gated calcium channel activity	IEA	biological process
GO:0099533	positive regulation of presynaptic cytosolic calcium concentration	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098883	synapse pruning	IEA	biological process
GO:0098794	postsynapse	IEA	cellular component
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0051402	neuron apoptotic process	IEA	biological process
GO:0050321	tau-protein kinase activity	IEA	molecular function
GO:0048167	regulation of synaptic plasticity	IEA	biological process
GO:0046875	ephrin receptor binding	IEA	molecular function
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0045055	regulated exocytosis	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0031175	neuron projection development	IEA	biological process
GO:0030866	cortical actin cytoskeleton organization	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0016572	histone phosphorylation	IEA	biological process
GO:0016533	protein kinase 5 complex	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0009611	response to wounding	IEA	biological process
GO:0008092	cytoskeletal protein binding	IEA	molecular function
GO:0007005	mitochondrion organization	IEA	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0070509	calcium ion import	IEA	biological process
GO:0060078	regulation of postsynaptic membrane potential	IEA	biological process
GO:0051402	neuron apoptotic process	IEA	biological process
GO:0048813	dendrite morphogenesis	IEA	biological process
GO:0048148	behavioral response to cocaine	IEA	biological process
GO:0045956	positive regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0042501	serine phosphorylation of STAT protein	IEA	biological process
GO:0035249	synaptic transmission, glutamatergic	IEA	biological process
GO:0032801	receptor catabolic process	IEA	biological process
GO:0032092	positive regulation of protein binding	IEA	biological process
GO:0031397	negative regulation of protein ubiquitination	IEA	biological process
GO:0030517	negative regulation of axon extension	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0030334	regulation of cell migration	IEA	biological process
GO:0030175	filopodium	IEA	cellular component
GO:0021819	layer formation in cerebral cortex	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0021697	cerebellar cortex formation	IEA	biological process
GO:0021695	cerebellar cortex development	IEA	biological process
GO:0021549	cerebellum development	IEA	biological process
GO:0021537	telencephalon development	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0014044	Schwann cell development	IEA	biological process
GO:0007160	cell-matrix adhesion	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005176	ErbB-2 class receptor binding	IEA	molecular function
GO:0002039	p53 binding	IEA	molecular function
GO:0001963	synaptic transmission, dopaminergic	IEA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:1901216	positive regulation of neuron death	IEA	biological process
GO:0099635	voltage-gated calcium channel activity involved in positive regulation of presynaptic cytosolic calcium levels	IEA	molecular function
GO:0098793	presynapse	IEA	cellular component
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0048488	synaptic vesicle endocytosis	IEA	biological process
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0034352	positive regulation of glial cell apoptotic process	IEA	biological process
GO:0031594	neuromuscular junction	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0030182	neuron differentiation	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0007519	skeletal muscle tissue development	IEA	biological process
GO:0006913	nucleocytoplasmic transport	IEA	biological process
GO:0006887	exocytosis	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:1903076	regulation of protein localization to plasma membrane	IEA	biological process
GO:0090314	positive regulation of protein targeting to membrane	IEA	biological process
GO:0061001	regulation of dendritic spine morphogenesis	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0051966	regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0051879	Hsp90 protein binding	IEA	molecular function
GO:0046826	negative regulation of protein export from nucleus	IEA	biological process
GO:0045860	positive regulation of protein kinase activity	IEA	biological process
GO:0045786	negative regulation of cell cycle	IEA	biological process
GO:0043125	ErbB-3 class receptor binding	IEA	molecular function
GO:0043113	receptor clustering	IEA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0035418	protein localization to synapse	IEA	biological process
GO:0031914	negative regulation of synaptic plasticity	IEA	biological process
GO:0030900	forebrain development	IEA	biological process
GO:0030549	acetylcholine receptor activator activity	IEA	molecular function
GO:0030182	neuron differentiation	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0022038	corpus callosum development	IEA	biological process
GO:0021987	cerebral cortex development	IEA	biological process
GO:0021954	central nervous system neuron development	IEA	biological process
GO:0019233	sensory perception of pain	IEA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IEA	biological process
GO:0008542	visual learning	IEA	biological process
GO:0008306	associative learning	IEA	biological process
GO:0008045	motor neuron axon guidance	IEA	biological process
GO:0007519	skeletal muscle tissue development	IEA	biological process
GO:0007416	synapse assembly	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0099703	induction of synaptic vesicle exocytosis by positive regulation of presynaptic cytosolic calcium ion concentration	IEA	biological process
GO:0099601	regulation of neurotransmitter receptor activity	IEA	biological process
GO:0099601	regulation of neurotransmitter receptor activity	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0043125	ErbB-3 class receptor binding	ISS	molecular function
GO:0031594	neuromuscular junction	ISS	cellular component
GO:0030549	acetylcholine receptor activator activity	ISS	molecular function
GO:0030426	growth cone	ISS	cellular component
GO:0016020	membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0050321	tau-protein kinase activity	ISS	molecular function
GO:0031175	neuron projection development	ISS	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0016301	kinase activity	ISS	molecular function
GO:0005176	ErbB-2 class receptor binding	ISS	molecular function
GO:0043525	positive regulation of neuron apoptotic process	ISS	biological process
GO:0043025	neuronal cell body	ISS	cellular component
GO:0030182	neuron differentiation	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa04360	Axon guidance
hsa05030	Cocaine addiction

Diseases

Associated diseases	References
Lissencephaly	KEGG:H00268
Lissencephaly	KEGG:H00268
Alzheimer's disease	PMID:15917097
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881