• Gene id: 10199

Gene Summary

• Gene Symbol: MPHOSPH10   Gene   UCSC   Ensembl
• Aliases: CT90, MPP10, MPP10P, PPP1R106
• Gene name: M-phase phosphoprotein 10
• Alternate names: U3 small nucleolar ribonucleoprotein protein MPP10, U3 small nucleolar ribonucleoprotein, m phase phosphoprotein 10, protein phosphatase 1, regulatory subunit 106,
• Gene location: 2p13.3 (71130633: 71150100)     Exons: 11     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein that is phosphorylated during mitosis. The protein localizes to the nucleolus during interphase and to the chromosomes during M phase. The protein associates with the U3 small nucleolar ribonucleoprotein 60-80S complexes and ma
• OMIM: 605503

Protein Summary

• Protein general information: O00566  
  • Name: U3 small nucleolar ribonucleoprotein protein MPP10 (M phase phosphoprotein 10)
  • Length: 681  
  • Mass: 78864
• Sequence:

  MAPQVWRRRTLERCLTEVGKATGRPECFLTIQEGLASKFTSLTKVLYDFNKILENGRIHGSPLQKLVIENFDDEQ
  IWQQLELQNEPILQYFQNAVSETINDEDISLLPESEEQEREEDGSEIEADDKEDLEDLEEEEVSDMGNDDPEMGE
  RAENSSKSDLRKSPVFSDEDSDLDFDISKLEQQSKVQNKGQGKPREKSIVDDKFFKLSEMEAYLENIEKEEERKD
  DNDEEEEDIDFFEDIDSDEDEGGLFGSKKLKSGKSSRNLKYKDFFDPVESDEDITNVHDDELDSNKEDDEIAEEE
  AEELSISETDEDDDLQENEDNKQHKESLKRVTFALPDDAETEDTGVLNVKKNSDEVKSSFEKRQEKMNEKIASLE
  KELLEKKPWQLQGEVTAQKRPENSLLEETLHFDHAVRMAPVITEETTLQLEDIIKQRIRDQAWDDVVRKEKPKED
  AYEYKKRLTLDHEKSKLSLAEIYEQEYIKLNQQKTAEEENPEHVEIQKMMDSLFLKLDALSNFHFIPKPPVPEIK
  VVSNLPAITMEEVAPVSVSDAALLAPEEIKEKNKAGDIKTAAEKTATDKKRERRKKKYQKRMKIKEKEKRRKLLE
  KSSVDQAGKYSKTVASEKLKQLTKTGKASFIKDEGKDKALKSSQAFFSKLQDQVKMQINDAKKTEKKKKKRQDIS
  VHKLKL

• Structural information:
  • Interpro: IPR012173  
  • STRING: ENSP00000244230
• Other Databases: GeneCards:  MPHOSPH10  Malacards:  MPHOSPH10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032040	small-subunit processome	IBA	cellular component
GO:0034457	Mpp10 complex	IBA	cellular component
GO:0010923	negative regulation of phosphatase activity	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005732	small nucleolar ribonucleoprotein complex	IEA	cellular component
GO:0006364	rRNA processing	IEA	biological process
GO:0034457	Mpp10 complex	IEA	cellular component
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0006364	rRNA processing	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006364	rRNA processing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0008380	RNA splicing	NAS	biological process
GO:0005732	small nucleolar ribonucleoprotein complex	NAS	cellular component
GO:0006396	RNA processing	NAS	biological process
GO:0000375	RNA splicing, via transesterification reactions	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881