• Gene id: 10196

Gene Summary

• Gene Symbol: PRMT3   Gene   UCSC   Ensembl
• Aliases: HRMT1L3
• Gene name: protein arginine methyltransferase 3
• Alternate names: protein arginine N-methyltransferase 3, HMT1 hnRNP methyltransferase-like 3, heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3,
• Gene location: 11p15.1 (20387529: 20510860)     Exons: 18     NC_000011.10
• Gene summary(Entrez): This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts on 40S ribosomal protein S2 (rpS2), which is its major in-vivo
• OMIM: 609507

Protein Summary

• Protein general information: O60678  
  • Name: Protein arginine N methyltransferase 3 (EC 2.1.1. ) (Heterogeneous nuclear ribonucleoprotein methyltransferase like protein 3)
  • Length: 531  
  • Mass: 59903
• Sequence:

  MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSAEETFSHCKSEHQFNI
  DSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYEPVSVPFSYPN
  GLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYG
  HYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLN
  KLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNK
  HADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTA
  IAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNST
  QTYGLQ

• Structural information:
  • Protein Domains: (217..53-)
    PRMT-type (/note="SAM-dependent-MTase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01015"-)
  • Interpro: IPR025799  IPR029063  IPR036236  IPR013087  
  • Prosite: PS51678 PS00028
  • PDB: 2FYT 3SMQ 4HSG 4QQN 4RYL
  • PDBsum: 2FYT 3SMQ 4HSG 4QQN 4RYL
  • STRING: ENSP00000331879
• Other Databases: GeneCards:  PRMT3  Malacards:  PRMT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0016274	protein-arginine N-methyltransferase activity	IEA	molecular function
GO:0018216	peptidyl-arginine methylation	IEA	biological process
GO:0032259	methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006479	protein methylation	TAS	biological process
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043022	ribosome binding	IEA	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	IEA	molecular function
GO:0006479	protein methylation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0008168	methyltransferase activity	IDA	molecular function
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0016274	protein-arginine N-methyltransferase activity	NAS	molecular function
GO:0005737	cytoplasm	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq