• Gene id: 10193

Gene Summary

• Gene Symbol: RNF41   Gene   UCSC   Ensembl
• Aliases: FLRF, NRDP1, SBBI03
• Gene name: ring finger protein 41
• Alternate names: E3 ubiquitin-protein ligase NRDP1, RING-type E3 ubiquitin transferase NRDP1, fetal liver ring finger, neuregulin receptor degradation protein-1, ring finger protein 41, E3 ubiquitin protein ligase,
• Gene location: 12q13.3 (100529922: 100523728)     Exons: 5     NC_000010.11
• Gene summary(Entrez): This gene encodes an E3 ubiquitin ligase. The encoded protein plays a role in type 1 cytokine receptor signaling by controlling the balance between JAK2-associated cytokine receptor degradation and ectodomain shedding. Alternative splicing results in mult

Protein Summary

• Protein general information: Q9H4P4  
  • Name: E3 ubiquitin protein ligase NRDP1 (EC 2.3.2.27) (RING finger protein 41) (RING type E3 ubiquitin transferase NRDP1)
  • Length: 317  
  • Mass: 35905
  • Tissue specificity: Detected in ovary, testis and prostate. {ECO
• Sequence:

  MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVVTVAHLRPVPRIMRNM
  LSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGCGLEMPKDELPNHNCIKHLRSVVQQQQTRIA
  ELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEYNEILEWVNSLQPARVTRWGGMISTPDAVL
  QAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRIPGKQAVVVMACENQHMGDDM
  VQEPGLVMIFAHGVEEI

• Structural information:
  • Interpro: IPR015036  IPR037255  IPR008974  IPR001841  IPR013083   IPR017907  IPR013010  
  • Prosite: PS00518 PS50089 PS51081
  • PDB: 2FZP 2GWF
  • PDBsum: 2FZP 2GWF
  • STRING: ENSP00000342755
• Other Databases: GeneCards:  RNF41  Malacards:  RNF41

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0010498	proteasomal protein catabolic process	IDA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IMP	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0071782	endoplasmic reticulum tubular network	IBA	cellular component
GO:0016567	protein ubiquitination	IBA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0043408	regulation of MAPK cascade	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0051896	regulation of protein kinase B signaling	IDA	biological process
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000114	regulation of establishment of cell polarity	IEA	biological process
GO:0005135	interleukin-3 receptor binding	IEA	molecular function
GO:0005128	erythropoietin receptor binding	IEA	molecular function
GO:1901525	negative regulation of mitophagy	IEA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0045637	regulation of myeloid cell differentiation	IEA	biological process
GO:0045619	regulation of lymphocyte differentiation	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	IMP	biological process
GO:0071782	endoplasmic reticulum tubular network	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:2000377	regulation of reactive oxygen species metabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0017160	Ral GTPase binding	IPI	molecular function
GO:0017160	Ral GTPase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881