• Gene id: 10186

Gene Summary

• Gene Symbol: LHFPL6   Gene   UCSC   Ensembl
• Aliases: LHFP
• Gene name: LHFPL tetraspan subfamily member 6
• Alternate names: LHFPL tetraspan subfamily member 6 protein, lipoma HMGIC fusion partner,
• Gene location: 13q13.3-q14.11 (39603192: 39342891)     Exons: 4     NC_000013.11
• Gene summary(Entrez): This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. This gene is fused to a high-mobility group gene in a translocation-associated lipoma. Mut
• OMIM: 606710

Protein Summary

• Protein general information: Q9Y693  
  • Name: LHFPL tetraspan subfamily member 6 protein (Lipoma HMGIC fusion partner)
  • Length: 200  
  • Mass: 21598
  • Tissue specificity: Pancreas, kidney, skeletal muscle, liver, lung brain, heart, colon, small intestine, uterus, testis, prostate, thymus, spleen and placenta. {ECO
• Sequence:

  MASSLTCTGVIWALLSFLCAATSCVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGRYASFQ
  GIPSAEWRICTIVTGLGCGLLLLVALTALMGCCVSDLISRTVGRVAGGIQFLGGLLIGAGCALYPLGWDSEEVRQ
  TCGYTSGQFDLGKCEIGWAYYCTGAGATAAMLLCTWLACFSGKKQKHYPY

• Structural information:
  • Interpro: IPR019372  
  • STRING: ENSP00000368908
• Other Databases: GeneCards:  LHFPL6  Malacards:  LHFPL6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)