• Gene id: 10179

Gene Summary

• Gene Symbol: RBM7   Gene   UCSC   Ensembl
• Gene name: RNA binding motif protein 7
• Alternate names: RNA-binding protein 7,
• Gene location: 11q23.2 (114400528: 114410609)     Exons: 5     NC_000011.10
• OMIM: 607623

Protein Summary

• Protein general information: Q9Y580  
  • Name: RNA binding protein 7 (RNA binding motif protein 7)
  • Length: 266  
  • Mass: 30504
  • Tissue specificity: Ubiquitous.
• Sequence:

  MGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKL
  YGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERTMDNMTSSAQIIQRSFSSPENFQRQAVMNSA
  LRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSD
  HHYRGKRDDFFYEDRNHDDWSHDYDNRRDSSRDGKWRSSRH

• Structural information:
  • Protein Domains: (10..8-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR034500  IPR000504  
  • Prosite: PS50102
  • CDD: cd12592
  • PDB: 2M8H 5IQQ 5LXR 5LXY
  • PDBsum: 2M8H 5IQQ 5LXR 5LXY
  • DIP: 48833
  • STRING: ENSP00000364639
• Other Databases: GeneCards:  RBM7  Malacards:  RBM7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003727	single-stranded RNA binding	IBA	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	NOT|cellular component
GO:0097157	pre-mRNA intronic binding	IDA	molecular function
GO:0071889	14-3-3 protein binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0017069	snRNA binding	IDA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0016076	snRNA catabolic process	IMP	biological process
GO:0071889	14-3-3 protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R