• Gene id: 10171

Gene Summary

• Gene Symbol: RCL1   Gene   UCSC   Ensembl
• Aliases: RNAC, RPCL1
• Gene name: RNA terminal phosphate cyclase like 1
• Alternate names: RNA 3'-terminal phosphate cyclase-like protein, RNA cyclase homolog,
• Gene location: 9p24.1 (4792833: 4861076)     Exons: 11     NC_000009.12
• OMIM: 604979

Protein Summary

• Protein general information: Q9Y2P8  
  • Name: RNA 3' terminal phosphate cyclase like protein
  • Length: 373  
  • Mass: 40843
• Sequence:

  MATQAHSLSYAGCNFLRQRLVLSTLSGRPVKIRKIRARDDNPGLRDFEASFIRLLDKITNGSRIEINQTGTTLYY
  QPGLLYGGSVEHDCSVLRGIGYYLESLLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATALPLLKQFGIDGESF
  ELKIVRRGMPPGGGGEVVFSCPVRKVLKPIQLTDPGKIKRIRGMAYSVRVSPQMANRIVDSARSILNKFIPDIYI
  YTDHMKGVNSGKSPGFGLSLVAETTSGTFLSAELASNPQGQGAAVLPEDLGRNCARLLLEEIYRGGCVDSTNQSL
  ALLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQIMFKIETKPCGEELKGGDKVLMTCVGIGFSNLSKTLK

• Structural information:
  • Interpro: IPR013791  IPR023797  IPR037136  IPR000228  IPR016443   IPR020719  IPR013792  IPR036553  
  • Prosite: PS01287
  • CDD: cd00875
  • STRING: ENSP00000371169
• Other Databases: GeneCards:  RCL1  Malacards:  RCL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000479	endonucleolytic cleavage of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA	biological process
GO:0004521	endoribonuclease activity	IBA	molecular function
GO:0005730	nucleolus	IBA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0006396	RNA processing	IEA	biological process
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006364	rRNA processing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IEA	biological process
GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0008150	biological_process	ND	biological process

KEGG pathways

Pathway id	Pathway name
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray