• Gene id: 10170

Gene Summary

• Gene Symbol: DHRS9   Gene   UCSC   Ensembl
• Aliases: 3-alpha-HSD, 3ALPHA-HSD, RDH-E2, RDH-TBE, RDH15, RDHL, RDHTBE, RETSDR8, SDR9C4
• Gene name: dehydrogenase/reductase 9
• Alternate names: dehydrogenase/reductase SDR family member 9, 3-alpha hydroxysteroid dehydrogenase, NADP-dependent retinol dehydrogenase/reductase, dehydrogenase/reductase (SDR family) member 9, retinol dehydrogenase 15, retinol dehydrogenase homolog, short chain dehydrogenase/,
• Gene location: 2q31.1 (134225460: 134150112)     Exons: 37     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoredu
• OMIM: 612131

Protein Summary

• Protein general information: Q9BPW9  
  • Name: Dehydrogenase/reductase SDR family member 9 (EC 1.1.1.209) (EC 1.1.1.53) (3 alpha hydroxysteroid dehydrogenase) (3 alpha HSD) (NADP dependent retinol dehydrogenase/reductase) (RDH E2) (RDHL) (Retinol dehydrogenase 15) (EC 1.1.1.105) (Short chain dehydroge
  • Length: 319  
  • Mass: 35227
  • Tissue specificity: Highly expressed in trachea and epidermis. Detected at lower levels in spinal cord, bone marrow, brain, tongue, esophagus, heart, colon, testis, placenta, lung, skeletal muscle and lymph node. {ECO
• Sequence:

  MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSE
  RLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLP
  LVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLA
  IWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAA
  LQDFLLLKQKAELANPKAV

• Structural information:
  • Interpro: IPR036291  IPR002347  
  • STRING: ENSP00000389241
• Other Databases: GeneCards:  DHRS9  Malacards:  DHRS9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0047044	androstan-3-alpha,17-beta-diol dehydrogenase activity	IDA	molecular function
GO:0047023	androsterone dehydrogenase activity	IDA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008202	steroid metabolic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004745	retinol dehydrogenase activity	IEA	molecular function
GO:0047044	androstan-3-alpha,17-beta-diol dehydrogenase activity	IEA	molecular function
GO:0047023	androsterone dehydrogenase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0004745	retinol dehydrogenase activity	IEA	molecular function
GO:0002138	retinoic acid biosynthetic process	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0042904	9-cis-retinoic acid biosynthetic process	IDA	biological process
GO:0047035	testosterone dehydrogenase (NAD+) activity	IDA	molecular function
GO:0042448	progesterone metabolic process	IDA	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:0004745	retinol dehydrogenase activity	IDA	molecular function
GO:0004022	alcohol dehydrogenase (NAD+) activity	IDA	molecular function
GO:0008209	androgen metabolic process	IDA	biological process
GO:0030855	epithelial cell differentiation	NAS	biological process
GO:0016854	racemase and epimerase activity	NAS	molecular function
GO:0042572	retinol metabolic process	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00830	Retinol metabolism

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R