• Gene id: 10164

Gene Summary

• Gene Symbol: CHST4   Gene   UCSC   Ensembl
• Aliases: GST3, GlcNAc6ST2, HECGLCNAC6ST, LSST
• Gene name: carbohydrate sulfotransferase 4
• Alternate names: carbohydrate sulfotransferase 4, GST-3, HEC-GlcNAc6ST, L-selectin ligand sulfotransferase, N-acetylglucosamine 6-O-sulfotransferase 2, carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4, galactose/N-acetylglucosamine/N-acetylgalactosamine 6-O-sulfotransf,
• Gene location: 16q22.2 (71526119: 71538747)     Exons: 3     NC_000016.10
• Gene summary(Entrez): This gene encodes an N-acetylglucosamine 6-O sulfotransferase. The encoded enzyme transfers sulfate from 3'phosphoadenosine 5'phospho-sulfate to the 6-hydroxyl group of N-acetylglucosamine on glycoproteins. This protein is localized to the Golgi and is in
• OMIM: 603551

Protein Summary

• Protein general information: Q8NCG5  
  • Name: Carbohydrate sulfotransferase 4 (EC 2.8.2. ) (Galactose/N acetylglucosamine/N acetylglucosamine 6 O sulfotransferase 3) (GST 3) (High endothelial cells N acetylglucosamine 6 O sulfotransferase) (HEC GlcNAc6ST) (L selectin ligand sulfotransferase) (LSST) (
  • Length: 386  
  • Mass: 45134
  • Tissue specificity: Specifically expressed in HEV. Weakly expressed in spleen. Not expressed in other tissues. Expressed in colonic mucinous adenocarcinoma. {ECO
• Sequence:

  MLLPKKMKLLLFLVSQMAILALFFHMYSHNISSLSMKAQPERMHVLVLSSWRSGSSFVGQLFGQHPDVFYLMEPA
  WHVWMTFKQSTAWMLHMAVRDLIRAVFLCDMSVFDAYMEPGPRRQSSLFQWENSRALCSAPACDIIPQDEIIPRA
  HCRLLCSQQPFEVVEKACRSYSHVVLKEVRFFNLQSLYPLLKDPSLNLHIVHLVRDPRAVFRSRERTKGDLMIDS
  RIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLP
  HLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYRHVRSEQEQRNLLLDL
  LSTWTVPEQIH

• Structural information:
  • Interpro: IPR016469  IPR027417  IPR000863  
  • STRING: ENSP00000341206
• Other Databases: GeneCards:  CHST4  Malacards:  CHST4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0006044	N-acetylglucosamine metabolic process	IBA	biological process
GO:0018146	keratan sulfate biosynthetic process	IBA	biological process
GO:0001517	N-acetylglucosamine 6-O-sulfotransferase activity	IBA	molecular function
GO:0006477	protein sulfation	IBA	biological process
GO:0006790	sulfur compound metabolic process	IBA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0006477	protein sulfation	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0001517	N-acetylglucosamine 6-O-sulfotransferase activity	TAS	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0016266	O-glycan processing	TAS	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0006790	sulfur compound metabolic process	IDA	biological process
GO:0001517	N-acetylglucosamine 6-O-sulfotransferase activity	IDA	molecular function
GO:0006044	N-acetylglucosamine metabolic process	IDA	biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0031228	intrinsic component of Golgi membrane	NAS	cellular component
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0006044	N-acetylglucosamine metabolic process	IBA	biological process
GO:0018146	keratan sulfate biosynthetic process	IBA	biological process
GO:0001517	N-acetylglucosamine 6-O-sulfotransferase activity	IBA	molecular function
GO:0006477	protein sulfation	IBA	biological process
GO:0006790	sulfur compound metabolic process	IBA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0006477	protein sulfation	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0001517	N-acetylglucosamine 6-O-sulfotransferase activity	TAS	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0016266	O-glycan processing	TAS	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0006790	sulfur compound metabolic process	IDA	biological process
GO:0001517	N-acetylglucosamine 6-O-sulfotransferase activity	IDA	molecular function
GO:0006044	N-acetylglucosamine metabolic process	IDA	biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0031228	intrinsic component of Golgi membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00533	Glycosaminoglycan biosynthesis - keratan sulfate

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq