• Gene id: 10163

Gene Summary

• Gene Symbol: WASF2   Gene   UCSC   Ensembl
• Aliases: IMD2, SCAR2, WASF4, WAVE2, dJ393P12.2
• Gene name: WASP family member 2
• Alternate names: wiskott-Aldrich syndrome protein family member 2, WAS protein family member 2, WASP family Verprolin-homologous protein 2, WASP family protein member 2, WASP family protein member 4, protein WAVE-2, putative Wiskott-Aldrich syndrome protein family member 4, supp,
• Gene location: 1p36.11 (27490166: 27404229)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all
• OMIM: 605875

Protein Summary

• Protein general information: Q9Y6W5  
  • Name: Wiskott Aldrich syndrome protein family member 2 (WASP family protein member 2) (Protein WAVE 2) (Verprolin homology domain containing protein 2)
  • Length: 498  
  • Mass: 54284
  • Tissue specificity: Expressed in all tissues with strongest expression in placenta, lung, and peripheral blood leukocytes, but not in skeletal muscle. {ECO
• Sequence:

  MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANTFASRVSSLAERVDRL
  QVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYRDDGKEALKFY
  TDPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYP
  PTLVYQNGSIGCVENVDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHP
  PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADY
  PTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPLSDTTKPKSSLPAVSDARSDLLSAIRQGFQL
  RRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSEFDEDDWSD

• Structural information:
  • Protein Domains: (436..45-)
    (/note="WH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00406"-)
  • Interpro: IPR028288  IPR003124  
  • Prosite: PS51082
  • PDB: 2A40
  • PDBsum: 2A40
  • DIP: 41817
  • STRING: ENSP00000483313
• Other Databases: GeneCards:  WASF2  Malacards:  WASF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0034237	protein kinase A regulatory subunit binding	IBA	molecular function
GO:2000601	positive regulation of Arp2/3 complex-mediated actin nucleation	IBA	biological process
GO:0030027	lamellipodium	IBA	cellular component
GO:0031209	SCAR complex	IBA	cellular component
GO:0071933	Arp2/3 complex binding	IBA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0003779	actin binding	TAS	molecular function
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0030036	actin cytoskeleton organization	TAS	biological process
GO:0030027	lamellipodium	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098974	postsynaptic actin cytoskeleton organization	IEA	biological process
GO:0030048	actin filament-based movement	IEA	biological process
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0030032	lamellipodium assembly	IEA	biological process
GO:0016601	Rac protein signal transduction	IEA	biological process
GO:0005911	cell-cell junction	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0001667	ameboidal-type cell migration	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0072673	lamellipodium morphogenesis	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0035855	megakaryocyte development	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0005769	early endosome	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0031209	SCAR complex	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0051497	negative regulation of stress fiber assembly	IMP	biological process
GO:0010592	positive regulation of lamellipodium assembly	IMP	biological process
GO:0010592	positive regulation of lamellipodium assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0031209	SCAR complex	IMP	cellular component
GO:0051018	protein kinase A binding	IPI	molecular function
GO:0017124	SH3 domain binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa04810	Regulation of actin cytoskeleton
hsa05130	Pathogenic Escherichia coli infection
hsa05135	Yersinia infection
hsa05231	Choline metabolism in cancer
hsa04666	Fc gamma R-mediated phagocytosis
hsa05100	Bacterial invasion of epithelial cells
hsa04520	Adherens junction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray