• Gene id: 10162

Gene Summary

• Gene Symbol: LPCAT3   Gene   UCSC   Ensembl
• Aliases: C3F, LPCAT, LPLAT 5, LPSAT, MBOAT5, OACT5, nessy
• Gene name: lysophosphatidylcholine acyltransferase 3
• Alternate names: lysophospholipid acyltransferase 5, 1-acylglycerophosphocholine O-acyltransferase, 1-acylglycerophosphoserine O-acyltransferase, O-acyltransferase (membrane bound) domain containing 5, O-acyltransferase domain-containing protein 5, lyso-PC acyltransferase 3, ly,
• Gene location: 12p13.31 (7018507: 6976184)     Exons: 13     NC_000012.12
• OMIM: 615638

Protein Summary

• Protein general information: Q6P1A2  
  • Name: Lysophospholipid acyltransferase 5 (LPLAT 5) (EC 2.3.1. ) (1 acylglycerophosphocholine O acyltransferase) (EC 2.3.1.23) (1 acylglycerophosphoserine O acyltransferase) (EC 2.3.1.n6) (Lysophosphatidylcholine acyltransferase) (LPCAT) (Lyso PC acyltransferase
  • Length: 487  
  • Mass: 56035
  • Tissue specificity: Highly expressed in liver, pancreas and adipose tissue. Very low expression in skeletal muscle and heart. Detected in neutrophils. {ECO
• Sequence:

  MASSAEGDEGTVVALAGVLQSGFQELSLNKLATSLGASEQALRLIISIFLGYPFALFYRHYLFYKETYLIHLFHT
  FTGLSIAYFNFGNQLYHSLLCIVLQFLILRLMGRTITAVLTTFCFQMAYLLAGYYYTATGNYDIKWTMPHCVLTL
  KLIGLAVDYFDGGKDQNSLSSEQQKYAIRGVPSLLEVAGFSYFYGAFLVGPQFSMNHYMKLVQGELIDIPGKIPN
  SIIPALKRLSLGLFYLVGYTLLSPHITEDYLLTEDYDNHPFWFRCMYMLIWGKFVLYKYVTCWLVTEGVCILTGL
  GFNGFEEKGKAKWDACANMKVWLFETNPRFTGTIASFNINTNAWVARYIFKRLKFLGNKELSQGLSLLFLALWHG
  LHSGYLVCFQMEFLIVIVERQAARLIQESPTLSKLAAITVLQPFYYLVQQTIHWLFMGYSMTAFCLFTWDKWLKV
  YKSIYFLGHIFFLSLLFILPYIHKAMVPRKEKLKKME

• Structural information:
  • Interpro: IPR004299  
  • STRING: ENSP00000261407
• Other Databases: GeneCards:  LPCAT3  Malacards:  LPCAT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006656	phosphatidylcholine biosynthetic process	IBA	biological process
GO:0016746	transferase activity, transferring acyl groups	IBA	molecular function
GO:0030258	lipid modification	IBA	biological process
GO:0047184	1-acylglycerophosphocholine O-acyltransferase activity	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:0071617	lysophospholipid acyltransferase activity	IBA	molecular function
GO:0036151	phosphatidylcholine acyl-chain remodeling	IDA	biological process
GO:0047184	1-acylglycerophosphocholine O-acyltransferase activity	IDA	molecular function
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0036151	phosphatidylcholine acyl-chain remodeling	IDA	biological process
GO:0047184	1-acylglycerophosphocholine O-acyltransferase activity	IDA	molecular function
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	IDA	biological process
GO:0036150	phosphatidylserine acyl-chain remodeling	IDA	biological process
GO:0036150	phosphatidylserine acyl-chain remodeling	IDA	biological process
GO:1905885	positive regulation of triglyceride transport	ISS	biological process
GO:0090158	endoplasmic reticulum membrane organization	ISS	biological process
GO:0036151	phosphatidylcholine acyl-chain remodeling	ISS	biological process
GO:0034379	very-low-density lipoprotein particle assembly	ISS	biological process
GO:1901310	positive regulation of sterol regulatory element binding protein cleavage	ISS	biological process
GO:0045797	positive regulation of intestinal cholesterol absorption	ISS	biological process
GO:0034378	chylomicron assembly	ISS	biological process
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0047184	1-acylglycerophosphocholine O-acyltransferase activity	IEA	molecular function
GO:0047184	1-acylglycerophosphocholine O-acyltransferase activity	IMP	molecular function
GO:0036150	phosphatidylserine acyl-chain remodeling	TAS	biological process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0036151	phosphatidylcholine acyl-chain remodeling	TAS	biological process
GO:0097006	regulation of plasma lipoprotein particle levels	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00564	Glycerophospholipid metabolism
hsa04216	Ferroptosis

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R