• Gene id: 1016

Gene Summary

• Gene Symbol: CDH18   Gene   UCSC   Ensembl
• Aliases: CDH14, CDH14L, CDH24
• Gene name: cadherin 18
• Alternate names: cadherin-18, cadherin 18, type 2, cadherin-14, cadherin-like 24, ey-cadherin,
• Gene location: 5p14.3 (20575885: 19471295)     Exons: 25     NC_000005.10
• Gene summary(Entrez): This gene encodes a type II classical cadherin from the cadherin superfamily of integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membra
• OMIM: 603019

Protein Summary

• Protein general information: Q13634  
  • Name: Cadherin 18 (Cadherin 14)
  • Length: 790  
  • Mass: 88,073
• Sequence:

  MKITSTSCICPVLVCLCFVQRCYGTAHHSSIKVMRNQTKHIEGETEVHHRPKRGWVWNQFFVLEEHMGPDPQYVG
  KLHSNSDKGDGSVKYILTGEGAGTIFIIDDTTGDIHSTKSLDREQKTHYVLHAQAIDRRTNKPLEPESEFIIKVQ
  DINDNAPKFTDGPYIVTVPEMSDMGTSVLQVTATDADDPTYGNSARVVYSILQGQPYFSVDPKTGVIRTALHNMD
  REAREHYSVVIQAKDMAGQVGGLSGSTTVNITLTDVNDNPPRFPQKHYQLYVPESAQVGSAVGKIKANDADTGSN
  ADMTYSIINGDGMGIFSISTDKETREGILSLKKPLNYEKKKSYTLNIEGANTHLDFRFSHLGPFKDATMLKIIVG
  DVDEPPLFSMPSYLMEVYENAKIGTVVGTVLAQDPDSTNSLVRYFINYNVEDDRFFNIDANTGTIRTTKVLDREE
  TPWYNITVTASEIDNPDLLSHVTVGIRVLDVNDNPPELAREYDIIVCENSKPGQVIHTISATDKDDFANGPRFNF
  FLDERLPVNPNFTLKDNEDNTASILTRRRRFSRTVQDVYYLPIMISDGGIPSLSSSSTLTIRVCACERDGRVRTC
  HAEAFLSSAGLSTGALIAILLCVLILLAIVVLFITLRRSKKEPLIISEEDVRENVVTYDDEGGGEEDTEAFDITA
  LRNPSAAEELKYRRDIRPEVKLTPRHQTSSTLESIDVQEFIKQRLAEADLDPSVPPYDSLQTYAYEGQRSEAGSI
  SSLDSATTQSDQDYHYLGDWGPEFKKLAELYGEIESERTT

• Structural information:
  • Protein Domains: Cadherin (54-159)
    Cadherin (160-268)
    Cadherin (269-383)
    Cadherin (384-486)
  • Interpro: IPR002126  IPR015919  IPR020894  IPR000233  IPR027397  
  • Prosite: PS00232 PS50268
  • STRING: ENSP00000274170
• Other Databases: GeneCards:  CDH18  Malacards:  CDH18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0034332	adherens junction organization	TAS	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0034332	adherens junction organization	TAS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0034332	adherens junction organization	TAS	biological process

Diseases

Associated diseases	References
Male factor infertility	MIK: 20180417
Azoospermia	MIK: 20180417
Azoospermia	MIK: 20180417
Cryptorchidism	MIK: 28606200
Low sperm motility	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20180417	Azoospermia				Male infertility	CDH18 PCDH17
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Low sperm motility			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray