Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 10152
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol ABI2   Gene   UCSC   Ensembl
Aliases ABI-2, ABI2B, AIP-1, AIP1, AblBP3, SSH3BP2, argBP1, argBPIA, argBPIB
Gene name abl interactor 2
Alternate names abl interactor 2, abelson interactor 2, abl binding protein 3, abl-interacting protein 1 (SH3-containing protein), abl-interactor protein 2b, arg protein tyrosine kinase-binding protein, arg-binding protein 1,
Gene location 2q33.2 (27212359: 27217182)     Exons: 7     NC_000002.12
OMIM 606442

Protein Summary
Protein general information Q9NYB9  

Name: Abl interactor 2 (Abelson interactor 2) (Abi 2) (Abl binding protein 3) (AblBP3) (Arg binding protein 1) (ArgBP1)

Length: 513  Mass: 55663

Tissue specificity: Widely expressed. Abundant in testes, ovary, thymus, and colon, with lower but detectable levels in prostate, peripheral blood leukocytes, and spleen. {ECO

Sequence MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQM
LDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIG
HGVKWLLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPSPTRNMAPSQ
QSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPAPAGSAGTPPLPATSAS
APAPLVPATVPSSTAPNAAAGGAPNLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHTPPTIGGSLPYRRPP
SITSQTSLQNQMNGGPFYSQNPVSDTPPPPPPVEEPVFDESPPPPPPPEDYEEEEAAVVEYSDPYAEEDPPWAPR
SYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESIMHYSE
Structural information
Protein Domains
 (45..10-)
homology (/note="t-SNARE-coiled-coil)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00202-)
(451..51-)
(/note="SH3-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
Interpro:  IPR028457  IPR036993  IPR035726  IPR012849  IPR036028  
IPR001452  IPR000727  
Prosite:   PS50002 PS50192
CDD:   cd11972

PDB:  		 2ED0 3P8C 4N78
PDBsum:   2ED0 3P8C 4N78

DIP:  
37566
MINT:  
STRING:   ENSP00000295851
Other Databases GeneCards:  ABI2  Malacards:  ABI2

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0017124 SH3 domain binding
 IBA molecular function
GO:0030027 lamellipodium
 IBA cellular component
GO:0070309 lens fiber cell morphogen
esis
 ISS biological process
GO:0043197 dendritic spine
 ISS is active in
GO:0061001 regulation of dendritic s
pine morphogenesis
 ISS biological process
GO:0008154 actin polymerization or d
epolymerization
 IEA biological process
GO:0030054 cell junction
 IEA cellular component
GO:0042995 cell projection
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0007399 nervous system developmen
t
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005856 cytoskeleton
 IEA cellular component
GO:0016032 viral process
 IEA biological process
GO:0003677 DNA binding
 TAS molecular function
GO:0018108 peptidyl-tyrosine phospho
rylation
 IDA biological process
GO:0005829 cytosol
 IDA cellular component
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0031625 ubiquitin protein ligase
binding
 IPI molecular function
GO:0005829 cytosol
 IDA cellular component
GO:0005912 adherens junction
 IEA cellular component
GO:0030175 filopodium
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0030027 lamellipodium
 IEA cellular component
GO:0005856 cytoskeleton
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0016601 Rac protein signal transd
uction
 IDA biological process
GO:0031209 SCAR complex
 IDA cellular component
GO:2000601 positive regulation of Ar
p2/3 complex-mediated act
in nucleation
 IDA biological process
GO:0032433 filopodium tip
 IDA cellular component
GO:0048365 Rac GTPase binding
 IDA contributes to
GO:0030027 lamellipodium
 IDA cellular component
GO:0070064 proline-rich region bindi
ng
 IPI molecular function
GO:0005737 cytoplasm
 TAS cellular component
GO:0017124 SH3 domain binding
 TAS molecular function
GO:0007010 cytoskeleton organization
 TAS biological process
GO:0019900 kinase binding
 NAS molecular function
GO:0008093 cytoskeletal anchor activ
ity
 TAS molecular function
GO:0017124 SH3 domain binding
 IPI molecular function
GO:0016477 cell migration
 TAS biological process
GO:0008154 actin polymerization or d
epolymerization
 NAS biological process
GO:0005515 protein binding
 IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04810Regulation of actin cytoskeleton

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract