• Gene id: 1015

Gene Summary

• Gene Symbol: CDH17   Gene   UCSC   Ensembl
• Aliases: CDH16, HPT-1, HPT1
• Gene name: cadherin 17
• Alternate names: cadherin-17, HPT-1 cadherin, LI cadherin, cadherin 17, LI cadherin (liver-intestine), cadherin-16, human intestinal peptide-associated transporter HPT-1, human peptide transporter 1, intestinal peptide-associated transporter HPT-1, liver-intestine cadherin,
• Gene location: 8q22.1 (94217277: 94127161)     Exons: 26     NC_000008.11
• Gene summary(Entrez): This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region
• OMIM: 603017

Protein Summary

• Protein general information: Q12864  
  • Name: Cadherin 17 (Intestinal peptide associated transporter HPT 1) (Liver intestine cadherin) (LI cadherin)
  • Length: 832  
  • Mass: 92219
  • Tissue specificity: Expressed in the gastrointestinal tract and pancreatic duct. Not detected in kidney, lung, liver, brain, adrenal gland and skin. {ECO
• Sequence:

  MILQAHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIERE
  GLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIKVKDINDNRPTFLQSKYEGSVRQNSRPGKPFLYVNA
  TDLDDPATPNGQLYYQIVIQLPMINNVMYFQINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFS
  DTTSVDIIVTENIWKAPKPVEMVENSTDPHPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDR
  EEKDAYVFYAVAKDEYGKPLSYPLEIHVKVKDINDNPPTCPSPVTVFEVQENERLGNSIGTLTAHDRDEENTANS
  FLNYRIVEQTPKLPMDGLFLIQTYAGMLQLAKQSLKKQDTPQYNLTIEVSDKDFKTLCFVQINVIDINDQIPIFE
  KSDYGNLTLAEDTNIGSTILTIQATDADEPFTGSSKILYHIIKGDSEGRLGVDTDPHTNTGYVIIKKPLDFETAA
  VSNIVFKAENPEPLVFGVKYNASSFAKFTLIVTDVNEAPQFSQHVFQAKVSEDVAIGTKVGNVTAKDPEGLDISY
  SLRGDTRGWLKIDHVTGEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVSEFHLILMDVNDNPPRLAKDYTGLF
  FCHPLSAPGSLIFEATDDDQHLFRGPHFTFSLGSGSLQNDWEVSKINGTHARLSTRHTEFEEREYVVLIRINDGG
  RPPLEGIVSLPVTFCSCVEGSCFRPAGHQTGIPTVGMAVGILLTTLLVIGIILAVVFIRIKKDKGKDNVESAQAS
  EVKPLRS

• Structural information:
  • Protein Domains: (30..12-)
    (/note="Cadherin-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00043-)
    (129..24-)
    (/note="Cadherin-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00043-)
    (245..34-)
    (/note="Cadherin-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:-)
  • Interpro: IPR039808  IPR002126  IPR015919  IPR020894  
  • Prosite: PS00232 PS50268
  • STRING: ENSP00000027335
• Other Databases: GeneCards:  CDH17  Malacards:  CDH17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000902	cell morphogenesis	IBA	biological process
GO:0005509	calcium ion binding	IBA	molecular function
GO:0005912	adherens junction	IBA	cellular component
GO:0034332	adherens junction organization	IBA	biological process
GO:0044331	cell-cell adhesion mediated by cadherin	IBA	biological process
GO:0045296	cadherin binding	IBA	molecular function
GO:0098742	cell-cell adhesion via plasma-membrane adhesion molecules	IBA	biological process
GO:0007043	cell-cell junction assembly	IBA	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0016339	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IBA	biological process
GO:0016342	catenin complex	IBA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005215	transporter activity	TAS	molecular function
GO:0007155	cell adhesion	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0034332	adherens junction organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0030183	B cell differentiation	IEA	biological process
GO:0006857	oligopeptide transport	IEA	biological process
GO:0048536	spleen development	IEA	biological process
GO:0016339	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005427	proton-dependent oligopeptide secondary active transmembrane transporter activity	IEA	molecular function
GO:0002315	marginal zone B cell differentiation	IEA	biological process
GO:0002314	germinal center B cell differentiation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0006857	oligopeptide transport	ISS	biological process
GO:0007229	integrin-mediated signaling pathway	IMP	biological process
GO:0033626	positive regulation of integrin activation by cell surface receptor linked signal transduction	IMP	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	ISS	biological process
GO:0005178	integrin binding	IPI	molecular function
GO:0035672	oligopeptide transmembrane transport	ISS	biological process
GO:0016339	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	ISS	biological process
GO:0005427	proton-dependent oligopeptide secondary active transmembrane transporter activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05226	Gastric cancer

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray