• Gene id: 10148

Gene Summary

• Gene Symbol: EBI3   Gene   UCSC   Ensembl
• Aliases: IL-27B, IL27B, IL35B
• Gene name: Epstein-Barr virus induced 3
• Alternate names: interleukin-27 subunit beta, EBV-induced gene 3 protein, Epstein-Barr virus induced gene 3, IL-27 subunit beta, IL27 subunit, IL35 subunit, cytokine receptor, epstein-Barr virus-induced gene 3 protein,
• Gene location: 19p13.3 (4229195: 4237538)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin
• OMIM: 616804

Protein Summary

• Protein general information: Q14213  
  • Name: Interleukin 27 subunit beta (IL 27 subunit beta) (IL 27B) (Epstein Barr virus induced gene 3 protein) (EBV induced gene 3 protein)
  • Length: 229  
  • Mass: 25396
• Sequence:

  MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGH
  SWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWE
  PPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATM
  SLGK

• Structural information:
  • Protein Domains: (24..13-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (131..22-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR003961  IPR036116  IPR003530  IPR013783  
  • Prosite: PS50853 PS01354
  • CDD: cd00063
  • DIP: 57556
  • STRING: ENSP00000221847
• Other Databases: GeneCards:  EBI3  Malacards:  EBI3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043235	receptor complex	IBA	cellular component
GO:0019955	cytokine binding	IBA	molecular function
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0045523	interleukin-27 receptor binding	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0004896	cytokine receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0006959	humoral immune response	TAS	biological process
GO:0070106	interleukin-27-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0070757	interleukin-35-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045523	interleukin-27 receptor binding	IEA	molecular function
GO:0042098	T cell proliferation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0045078	positive regulation of interferon-gamma biosynthetic process	TAS	biological process
GO:0042088	T-helper 1 type immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0046641	positive regulation of alpha-beta T cell proliferation	TAS	biological process
GO:0004896	cytokine receptor activity	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R