• Gene id: 10140

Gene Summary

• Gene Symbol: TOB1   Gene   UCSC   Ensembl
• Aliases: APRO5, APRO6, PIG49, TOB, TROB, TROB1
• Gene name: transducer of ERBB2, 1
• Alternate names: protein Tob1, proliferation-inducing gene 49, transducer of erbB-2 1,
• Gene location: 17q21.33 (50867977: 50862222)     Exons: 4     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the transducer of erbB-2 /B-cell translocation gene protein family. Members of this family are anti-proliferative factors that have the potential to regulate cell growth. The encoded protein may function as a tumor suppressor
• OMIM: 605523

Protein Summary

• Protein general information: P50616  
  • Name: Protein Tob1 (Transducer of erbB 2 1)
  • Length: 345  
  • Mass: 38155
  • Tissue specificity: Ubiquitous.
• Sequence:

  MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKES
  GLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVS
  SSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSS
  MHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSP
  LQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN

• Structural information:
  • Interpro: IPR002087  IPR036054  IPR015677  IPR015676  
  • Prosite: PS00960 PS01203
  • PDB: 2D5R 2Z15 5CI8 5CI9
  • PDBsum: 2D5R 2Z15 5CI8 5CI9
  • STRING: ENSP00000427695
• Other Databases: GeneCards:  TOB1  Malacards:  TOB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0030014	CCR4-NOT complex	IDA	cellular component
GO:0017148	negative regulation of translation	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	biological process
GO:0060213	positive regulation of nuclear-transcribed mRNA poly(A) tail shortening	IDA	biological process
GO:0060212	negative regulation of nuclear-transcribed mRNA poly(A) tail shortening	IDA	biological process
GO:0030971	receptor tyrosine kinase binding	IDA	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060390	regulation of SMAD protein signal transduction	IEA	biological process
GO:0046332	SMAD binding	IEA	molecular function
GO:0045668	negative regulation of osteoblast differentiation	IEA	biological process
GO:0030514	negative regulation of BMP signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881