• Gene id: 1014

Gene Summary

• Gene Symbol: CDH16   Gene   UCSC   Ensembl
• Gene name: cadherin 16
• Alternate names: cadherin-16, KSP-cadherin, cadherin 16, KSP-cadherin, kidney-specific cadherin,
• Gene location: 16q22.1 (66918884: 66908121)     Exons: 18     NC_000016.10
• Gene summary(Entrez): This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. Mapped to a previously identified cluster of cadherin genes on chromosome 16q22.1, the gene localizes with superfamily members CDH1, CD
• OMIM: 606490

SNPs

rs879255539

Strand:    Allele origin:   Allele change:   Mutation type: delins

NC_000023.11   g.19003070_19003074delinsTCT
NC_000023.10   g.19021188_19021192delinsTCT
NG_021304.1   g.124564_124568delinsAGA
NM_005756.3   c.1993_1997delinsAGA
NM_005756.4   c.1993_1997delinsAGA
NM_001079858.3   c.2002_2006delinsAGA
NM_001079858.2   c.2002_2006d

rs879255538

Strand:    Allele origin:   Allele change:   Mutation type: delins

NC_000023.11   g.18994921del
NC_000023.10   g.19013039del
NG_021304.1   g.132718del
NM_005756.3   c.2836del
NM_005756.4   c.2836del
NM_001079858.3   c.2845del
NM_001079858.2   c.2845del
NM_001079859.2   c.2803del
NM_001079859.3   c.2803del
NM_001079860.2   c.2779del
NM_  

Protein Summary

• Protein general information: O75309  
  • Name: Cadherin 16 (Kidney specific cadherin) (Ksp cadherin)
  • Length: 829  
  • Mass: 89923
  • Tissue specificity: Kidney specific.
• Sequence:

  MVPAWLWLLCVSVPQALPKAQPAELSVEVPENYGGNFPLYLTKLPLPREGAEGQIVLSGDSGKATEGPFAMDPDS
  GFLLVTRALDREEQAEYQLQVTLEMQDGHVLWGPQPVLVHVKDENDQVPHFSQAIYRARLSRGTRPGIPFLFLEA
  SDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLDHALERTYQLLVQVKDMGDQASGHQA
  TATVEVSIIESTWVSLEPIHLAENLKVLYPHHMAQVHWSGGDVHYHLESHPPGPFEVNAEGNLYVTRELDREAQA
  EYLLQVRAQNSHGEDYAAPLELHVLVMDENDNVPICPPRDPTVSIPELSPPGTEVTRLSAEDADAPGSPNSHVVY
  QLLSPEPEDGVEGRAFQVDPTSGSVTLGVLPLRAGQNILLLVLAMDLAGAEGGFSSTCEVEVAVTDINDHAPEFI
  TSQIGPISLPEDVEPGTLVAMLTAIDADLEPAFRLMDFAIERGDTEGTFGLDWEPDSGHVRLRLCKNLSYEAAPS
  HEVVVVVQSVAKLVGPGPGPGATATVTVLVERVMPPPKLDQESYEASVPISAPAGSFLLTIQPSDPISRTLRFSL
  VNDSEGWLCIEKFSGEVHTAQSLQGAQPGDTYTVLVEAQDTDEPRLSASAPLVIHFLKAPPAPALTLAPVPSQYL
  CTPRQDHGLIVSGPSKDPDLASGHGPYSFTLGPNPTVQRDWRLQTLNGSHAYLTLALHWVEPREHIIPVVVSHNA
  QMWQLLVRVIVCRCNVEGQCMRKVGRMKGMPTKLSAVGILVGTLVAIGIFLILIFTHWTMSRKKDPDQPADSVPL
  KATV

• Structural information:
  • Protein Domains: (25..12-)
    (/note="Cadherin-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00043-)
    (131..23-)
    (/note="Cadherin-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00043-)
    (242..33-)
    (/note="Cadherin-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:-)
  • Interpro: IPR030721  IPR002126  IPR015919  IPR020894  
  • Prosite: PS00232 PS50268
  • STRING: ENSP00000299752
• Other Databases: GeneCards:  CDH16  Malacards:  CDH16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007155	cell adhesion	IBA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016339	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0016339	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
thyroid gland cancer	PMID:22028439
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881