• Gene id: 10139

Gene Summary

• Gene Symbol: ARFRP1   Gene   UCSC   Ensembl
• Aliases: ARL18, ARP, Arp1
• Gene name: ADP ribosylation factor related protein 1
• Alternate names: ADP-ribosylation factor-related protein 1, ARF-related protein 1, SCG10 like-protein, epididymis secretory sperm binding protein, helicase-like protein NHL,
• Gene location: 20q13.33 (63708012: 63698641)     Exons: 10     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a membrane-associated GTP-ase which localizes to the plasma membrane and is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) proteins. This gene plays a role in membrane trafficking between the trans-Golg
• OMIM: 615857

Protein Summary

• Protein general information: Q13795  
  • Name: ADP ribosylation factor related protein 1 (ARF related protein 1) (ARP)
  • Length: 201  
  • Mass: 22614
  • Tissue specificity: Found in most tissues.
• Sequence:

  MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWD
  LGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTA
  FSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR006689  
  • Prosite: PS51417
  • STRING: ENSP00000483486
• Other Databases: GeneCards:  ARFRP1  Malacards:  ARFRP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0043001	Golgi to plasma membrane protein transport	IBA	biological process
GO:0033365	protein localization to organelle	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0016020	membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0007369	gastrulation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0043001	Golgi to plasma membrane protein transport	IMP	biological process
GO:0043001	Golgi to plasma membrane protein transport	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0034067	protein localization to Golgi apparatus	IMP	biological process
GO:0042147	retrograde transport, endosome to Golgi	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq